Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E1C5

Protein Details
Accession A5E1C5    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-44GDENKQKKLIKIKHKKRDKRLPVPSNIRILKBasic
NLS Segment(s)
PositionSequence
18-34KQKKLIKIKHKKRDKRL
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
KEGG lel:LELG_03412  -  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSRAEYLAKYLSGGDENKQKKLIKIKHKKRDKRLPVPSNIRILKLVFHEPPPPPPSSSTSLSSSAALALVSSLDSADLDTIYGDEESRPVVVKNVKENKGFKRIDNGTLVEPSSLDSSSNAIAKQTFQNKTTPSNQAPETIFRDSSGKIIDIKEAQRDFELRKEEERRRKETIEVRSSKQQQLEQETRVFKSSLDKNFEDPVSVFQESRRIKNESEDIEKSKFVFNKGINPPNRFDIPAGYFWDGVDRSNGFESLMLRKINEQSYDKMSSKVDQDYELDFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.29
3 0.33
4 0.36
5 0.41
6 0.42
7 0.44
8 0.53
9 0.58
10 0.6
11 0.68
12 0.75
13 0.79
14 0.88
15 0.92
16 0.93
17 0.94
18 0.94
19 0.93
20 0.94
21 0.92
22 0.92
23 0.91
24 0.85
25 0.84
26 0.74
27 0.65
28 0.56
29 0.47
30 0.4
31 0.34
32 0.35
33 0.27
34 0.28
35 0.33
36 0.32
37 0.39
38 0.39
39 0.37
40 0.33
41 0.34
42 0.37
43 0.36
44 0.38
45 0.34
46 0.34
47 0.34
48 0.33
49 0.3
50 0.25
51 0.2
52 0.16
53 0.12
54 0.08
55 0.05
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.06
77 0.11
78 0.15
79 0.18
80 0.27
81 0.36
82 0.4
83 0.45
84 0.51
85 0.52
86 0.58
87 0.56
88 0.48
89 0.48
90 0.46
91 0.44
92 0.42
93 0.37
94 0.29
95 0.28
96 0.27
97 0.18
98 0.15
99 0.12
100 0.1
101 0.09
102 0.07
103 0.07
104 0.08
105 0.09
106 0.1
107 0.09
108 0.08
109 0.08
110 0.1
111 0.14
112 0.21
113 0.22
114 0.22
115 0.26
116 0.28
117 0.32
118 0.35
119 0.36
120 0.3
121 0.31
122 0.31
123 0.3
124 0.3
125 0.28
126 0.28
127 0.23
128 0.21
129 0.18
130 0.19
131 0.16
132 0.16
133 0.14
134 0.11
135 0.11
136 0.11
137 0.12
138 0.14
139 0.15
140 0.19
141 0.18
142 0.18
143 0.17
144 0.19
145 0.19
146 0.2
147 0.24
148 0.19
149 0.25
150 0.33
151 0.41
152 0.49
153 0.55
154 0.56
155 0.57
156 0.57
157 0.58
158 0.57
159 0.58
160 0.58
161 0.56
162 0.53
163 0.57
164 0.6
165 0.57
166 0.53
167 0.46
168 0.41
169 0.45
170 0.46
171 0.4
172 0.41
173 0.4
174 0.37
175 0.36
176 0.32
177 0.23
178 0.27
179 0.31
180 0.32
181 0.36
182 0.36
183 0.37
184 0.4
185 0.4
186 0.34
187 0.27
188 0.23
189 0.22
190 0.22
191 0.19
192 0.16
193 0.26
194 0.27
195 0.31
196 0.32
197 0.31
198 0.31
199 0.37
200 0.42
201 0.39
202 0.43
203 0.43
204 0.42
205 0.41
206 0.41
207 0.36
208 0.36
209 0.33
210 0.28
211 0.31
212 0.29
213 0.36
214 0.44
215 0.52
216 0.53
217 0.54
218 0.55
219 0.53
220 0.53
221 0.45
222 0.37
223 0.34
224 0.31
225 0.31
226 0.32
227 0.29
228 0.27
229 0.25
230 0.29
231 0.23
232 0.2
233 0.21
234 0.17
235 0.17
236 0.19
237 0.19
238 0.14
239 0.16
240 0.18
241 0.19
242 0.24
243 0.22
244 0.21
245 0.25
246 0.3
247 0.33
248 0.37
249 0.35
250 0.35
251 0.41
252 0.47
253 0.44
254 0.42
255 0.39
256 0.37
257 0.38
258 0.39
259 0.34
260 0.3
261 0.31