Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75A51

Protein Details
Accession Q75A51   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
343-365QAIFEKYSKSRHRRSAQVVARWIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 10, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039361  Cyclin  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR046965  Cyclin_A/B-like  
IPR004367  Cyclin_C-dom  
IPR006671  Cyclin_N  
Gene Ontology GO:0000307  C:cyclin-dependent protein kinase holoenzyme complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0051301  P:cell division  
GO:0006310  P:DNA recombination  
GO:0044772  P:mitotic cell cycle phase transition  
GO:1900087  P:positive regulation of G1/S transition of mitotic cell cycle  
GO:0032436  P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
KEGG ago:AGOS_ADR068W  -  
Pfam View protein in Pfam  
PF02984  Cyclin_C  
PF00134  Cyclin_N  
PROSITE View protein in PROSITE  
PS00292  CYCLINS  
CDD cd20568  CYCLIN_CLBs_yeast_rpt1  
cd20512  CYCLIN_CLBs_yeast_rpt2  
Amino Acid Sequences MYGARAGNENSGAGAAGSRAGRRGSGGSGGPRVALGDVTAQVNNRGPRAGGKDARAGKPQGDAAVQGGENVEETVRAVGPVWDAAAEAAVAAAAAEYGGAPDPADEDTWDAVMVAEYAPEIFAYLRGLEVRFAPAADYMRGQPELRWEYRATLVDWLVQVHCRFQLLPETLYLTVNIIDRFLSRKTVTLNRFQLVGAAALFIASKYEEINCPTLRELLYMLDNAYTADEVLKAERYMIDTLEFEFGWPGPMSFLRRVSKADNYEYDIRTLAKYLLETTIMDPRLVAAPPSWLAAGAYYLSRIIIGYNTWTRQHVFYSGYTAEQLVSLATVILENCRHAETRHQAIFEKYSKSRHRRSAQVVARWIAMAEENLQPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.06
3 0.09
4 0.11
5 0.11
6 0.14
7 0.14
8 0.15
9 0.17
10 0.19
11 0.18
12 0.2
13 0.23
14 0.25
15 0.28
16 0.28
17 0.26
18 0.23
19 0.22
20 0.18
21 0.14
22 0.1
23 0.09
24 0.1
25 0.12
26 0.13
27 0.13
28 0.16
29 0.21
30 0.23
31 0.22
32 0.21
33 0.2
34 0.24
35 0.3
36 0.36
37 0.36
38 0.37
39 0.44
40 0.5
41 0.54
42 0.54
43 0.49
44 0.42
45 0.4
46 0.38
47 0.32
48 0.26
49 0.22
50 0.18
51 0.19
52 0.17
53 0.13
54 0.12
55 0.1
56 0.1
57 0.09
58 0.08
59 0.05
60 0.06
61 0.07
62 0.06
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.04
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.08
96 0.08
97 0.07
98 0.06
99 0.06
100 0.06
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.03
109 0.04
110 0.05
111 0.05
112 0.06
113 0.07
114 0.07
115 0.08
116 0.08
117 0.1
118 0.09
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.11
125 0.1
126 0.13
127 0.14
128 0.14
129 0.13
130 0.19
131 0.24
132 0.24
133 0.26
134 0.24
135 0.24
136 0.28
137 0.28
138 0.21
139 0.18
140 0.18
141 0.16
142 0.16
143 0.15
144 0.12
145 0.13
146 0.12
147 0.11
148 0.11
149 0.1
150 0.1
151 0.1
152 0.16
153 0.15
154 0.16
155 0.15
156 0.17
157 0.17
158 0.17
159 0.16
160 0.1
161 0.09
162 0.1
163 0.09
164 0.07
165 0.07
166 0.07
167 0.09
168 0.1
169 0.12
170 0.11
171 0.12
172 0.16
173 0.24
174 0.26
175 0.32
176 0.34
177 0.32
178 0.32
179 0.3
180 0.27
181 0.2
182 0.18
183 0.09
184 0.06
185 0.06
186 0.05
187 0.05
188 0.04
189 0.03
190 0.03
191 0.03
192 0.04
193 0.05
194 0.06
195 0.08
196 0.13
197 0.13
198 0.14
199 0.14
200 0.16
201 0.15
202 0.14
203 0.13
204 0.1
205 0.11
206 0.1
207 0.1
208 0.08
209 0.08
210 0.07
211 0.07
212 0.05
213 0.04
214 0.04
215 0.04
216 0.05
217 0.06
218 0.06
219 0.06
220 0.07
221 0.07
222 0.09
223 0.09
224 0.1
225 0.1
226 0.09
227 0.1
228 0.12
229 0.11
230 0.09
231 0.09
232 0.08
233 0.09
234 0.09
235 0.08
236 0.08
237 0.1
238 0.14
239 0.16
240 0.23
241 0.23
242 0.25
243 0.28
244 0.3
245 0.35
246 0.36
247 0.38
248 0.34
249 0.37
250 0.41
251 0.39
252 0.36
253 0.3
254 0.26
255 0.22
256 0.21
257 0.16
258 0.11
259 0.11
260 0.12
261 0.12
262 0.12
263 0.12
264 0.13
265 0.18
266 0.18
267 0.17
268 0.16
269 0.16
270 0.17
271 0.16
272 0.15
273 0.09
274 0.11
275 0.11
276 0.13
277 0.11
278 0.09
279 0.09
280 0.09
281 0.09
282 0.07
283 0.07
284 0.06
285 0.07
286 0.06
287 0.06
288 0.06
289 0.06
290 0.06
291 0.07
292 0.12
293 0.16
294 0.19
295 0.21
296 0.23
297 0.24
298 0.25
299 0.27
300 0.25
301 0.23
302 0.21
303 0.25
304 0.24
305 0.23
306 0.22
307 0.2
308 0.17
309 0.14
310 0.13
311 0.07
312 0.06
313 0.05
314 0.05
315 0.04
316 0.05
317 0.05
318 0.08
319 0.09
320 0.1
321 0.12
322 0.14
323 0.15
324 0.16
325 0.25
326 0.3
327 0.38
328 0.41
329 0.42
330 0.42
331 0.45
332 0.52
333 0.47
334 0.47
335 0.42
336 0.48
337 0.56
338 0.63
339 0.69
340 0.72
341 0.75
342 0.77
343 0.82
344 0.83
345 0.82
346 0.81
347 0.78
348 0.69
349 0.62
350 0.52
351 0.43
352 0.33
353 0.26
354 0.18
355 0.15