Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KZD8

Protein Details
Accession A0A4Z1KZD8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MASKSNPNVPQKKRKIANRAKTQRKNAINKVTKNHydrophilic
NLS Segment(s)
PositionSequence
11-33QKKRKIANRAKTQRKNAINKVTK
Subcellular Location(s) nucl 20, mito 4.5, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MASKSNPNVPQKKRKIANRAKTQRKNAINKVTKNPRGTRASTVLFPTSGPLAPLSGKKARKVQKAQNCARQRALEQAMKEGEVKMTDAPETTSNAASEGMEVDNIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.88
6 0.89
7 0.9
8 0.9
9 0.9
10 0.88
11 0.87
12 0.85
13 0.83
14 0.83
15 0.8
16 0.77
17 0.78
18 0.79
19 0.76
20 0.74
21 0.69
22 0.66
23 0.63
24 0.59
25 0.54
26 0.49
27 0.44
28 0.39
29 0.37
30 0.3
31 0.24
32 0.21
33 0.17
34 0.13
35 0.1
36 0.09
37 0.07
38 0.07
39 0.08
40 0.09
41 0.12
42 0.18
43 0.19
44 0.23
45 0.31
46 0.38
47 0.46
48 0.53
49 0.58
50 0.61
51 0.7
52 0.73
53 0.75
54 0.74
55 0.69
56 0.65
57 0.57
58 0.49
59 0.47
60 0.45
61 0.39
62 0.33
63 0.33
64 0.3
65 0.29
66 0.29
67 0.21
68 0.17
69 0.14
70 0.14
71 0.11
72 0.11
73 0.11
74 0.11
75 0.12
76 0.13
77 0.15
78 0.16
79 0.16
80 0.15
81 0.16
82 0.16
83 0.14
84 0.13
85 0.11
86 0.09