Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KLB8

Protein Details
Accession A0A4Z1KLB8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-84TAPPPPPPPTRKRTSRRGPTPRBasic
NLS Segment(s)
PositionSequence
69-84PPPTRKRTSRRGPTPR
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MERNSPLPWGWKCKRMVEIWSDPEIPPSTLSLRSCGTLNEGEDVCTACNTYIEIATFEVVHQTAPPPPPPPTRKRTSRRGPTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.51
4 0.49
5 0.52
6 0.49
7 0.49
8 0.45
9 0.4
10 0.39
11 0.36
12 0.28
13 0.21
14 0.18
15 0.16
16 0.18
17 0.18
18 0.18
19 0.17
20 0.17
21 0.17
22 0.15
23 0.16
24 0.13
25 0.13
26 0.13
27 0.12
28 0.12
29 0.12
30 0.12
31 0.09
32 0.08
33 0.07
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.07
50 0.11
51 0.14
52 0.17
53 0.19
54 0.24
55 0.34
56 0.42
57 0.49
58 0.53
59 0.6
60 0.68
61 0.73
62 0.79
63 0.8
64 0.84