Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KKW6

Protein Details
Accession A0A4Z1KKW6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-51DAEFNGPKRSRRGKKKKKLKVDFSEIPBasic
NLS Segment(s)
PositionSequence
31-44PKRSRRGKKKKKLK
87-91GRAGR
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MDASRRVSLVAIGYRLLIDKDATVDAEFNGPKRSRRGKKKKKLKVDFSEIPGLEVGPELTPVRSGSYQEVMNRSGQGRARQGRAGQGRAGRRGGGQEKTSQEEHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.11
5 0.09
6 0.08
7 0.09
8 0.1
9 0.1
10 0.1
11 0.1
12 0.09
13 0.13
14 0.13
15 0.13
16 0.19
17 0.2
18 0.22
19 0.3
20 0.41
21 0.47
22 0.58
23 0.68
24 0.73
25 0.82
26 0.9
27 0.92
28 0.93
29 0.93
30 0.92
31 0.88
32 0.86
33 0.79
34 0.72
35 0.67
36 0.56
37 0.46
38 0.35
39 0.27
40 0.18
41 0.13
42 0.1
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.09
50 0.09
51 0.1
52 0.11
53 0.14
54 0.16
55 0.18
56 0.2
57 0.19
58 0.2
59 0.2
60 0.18
61 0.2
62 0.22
63 0.25
64 0.31
65 0.35
66 0.37
67 0.39
68 0.4
69 0.44
70 0.47
71 0.44
72 0.4
73 0.42
74 0.44
75 0.45
76 0.45
77 0.37
78 0.32
79 0.38
80 0.39
81 0.39
82 0.36
83 0.38
84 0.41
85 0.45