Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1L4H9

Protein Details
Accession A0A4Z1L4H9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-54ASKFKTNTTDGKRNKNKNKNKNNNKNKNKNKNKNKNKKWQQQKNTGASSHydrophilic
NLS Segment(s)
PositionSequence
17-43KRNKNKNKNKNNNKNKNKNKNKNKNKK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MIIDQASKFKTNTTDGKRNKNKNKNKNNNKNKNKNKNKNKNKKWQQQKNTGASSTRTTPVPLGLDQQQNDLLSLLDLDLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.65
4 0.72
5 0.79
6 0.84
7 0.85
8 0.87
9 0.88
10 0.92
11 0.93
12 0.94
13 0.94
14 0.95
15 0.95
16 0.95
17 0.95
18 0.95
19 0.95
20 0.95
21 0.94
22 0.94
23 0.94
24 0.95
25 0.95
26 0.94
27 0.94
28 0.93
29 0.92
30 0.92
31 0.91
32 0.89
33 0.88
34 0.87
35 0.83
36 0.75
37 0.67
38 0.58
39 0.5
40 0.44
41 0.36
42 0.29
43 0.23
44 0.2
45 0.19
46 0.2
47 0.2
48 0.18
49 0.18
50 0.22
51 0.27
52 0.27
53 0.28
54 0.28
55 0.25
56 0.25
57 0.22
58 0.16
59 0.11
60 0.1
61 0.08