Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1L3Z6

Protein Details
Accession A0A4Z1L3Z6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-102ATDKTMTQKRRADRKNKKLAESLSHydrophilic
NLS Segment(s)
PositionSequence
43-57RWSGRSGKLRNAKKR
89-93RADRK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MAEQCYENGIQVFQITPFITMSLSTQPKNSNAELTPEPVPIKRWSGRSGKLRNAKKRYARELPTLAPEYRELGRDADRATDKTMTQKRRADRKNKKLAESLSDLSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.1
6 0.1
7 0.09
8 0.11
9 0.16
10 0.19
11 0.19
12 0.22
13 0.24
14 0.27
15 0.31
16 0.3
17 0.26
18 0.23
19 0.27
20 0.26
21 0.26
22 0.24
23 0.22
24 0.22
25 0.19
26 0.21
27 0.18
28 0.23
29 0.23
30 0.25
31 0.29
32 0.34
33 0.4
34 0.47
35 0.5
36 0.53
37 0.59
38 0.64
39 0.69
40 0.69
41 0.7
42 0.69
43 0.7
44 0.7
45 0.69
46 0.65
47 0.61
48 0.58
49 0.52
50 0.49
51 0.45
52 0.37
53 0.3
54 0.26
55 0.23
56 0.2
57 0.2
58 0.16
59 0.15
60 0.17
61 0.18
62 0.18
63 0.2
64 0.22
65 0.22
66 0.24
67 0.24
68 0.22
69 0.3
70 0.38
71 0.4
72 0.45
73 0.51
74 0.57
75 0.66
76 0.75
77 0.77
78 0.8
79 0.84
80 0.87
81 0.87
82 0.83
83 0.81
84 0.75
85 0.71
86 0.66