Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KKZ1

Protein Details
Accession A0A4Z1KKZ1   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKPTRKNPSKELRRPLDLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 4.5, nucl 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005180  DUF302  
IPR035923  TT1751-like_sf  
Pfam View protein in Pfam  
PF03625  DUF302  
CDD cd14797  DUF302  
Amino Acid Sequences MTKPTRKNPSKELRRPLDLKDLCCFGEFDHGSWLSLFDINSNPQLGVKRIILGNPLIAITMLSQSTKSLDAGLFVPVEILVRQLSDEEGTEIMWQVPSTLIAALNRGYNELLNAAHVLDRKLEGLIAFIGRDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.72
4 0.72
5 0.65
6 0.58
7 0.51
8 0.46
9 0.38
10 0.35
11 0.31
12 0.2
13 0.26
14 0.24
15 0.21
16 0.23
17 0.23
18 0.22
19 0.22
20 0.22
21 0.13
22 0.14
23 0.13
24 0.09
25 0.11
26 0.12
27 0.13
28 0.13
29 0.12
30 0.12
31 0.14
32 0.14
33 0.15
34 0.14
35 0.15
36 0.14
37 0.15
38 0.15
39 0.13
40 0.12
41 0.09
42 0.09
43 0.07
44 0.06
45 0.06
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.05
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.09
90 0.09
91 0.11
92 0.11
93 0.12
94 0.12
95 0.1
96 0.11
97 0.11
98 0.1
99 0.09
100 0.09
101 0.09
102 0.1
103 0.12
104 0.12
105 0.12
106 0.13
107 0.13
108 0.13
109 0.13
110 0.11
111 0.11
112 0.12
113 0.11