Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KJV6

Protein Details
Accession A0A4Z1KJV6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-136DAVNPESRKNKKKPPTASNLCAFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 8.5, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR005302  MoCF_Sase_C  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030151  F:molybdenum ion binding  
GO:0030170  F:pyridoxal phosphate binding  
Pfam View protein in Pfam  
PF03473  MOSC  
PROSITE View protein in PROSITE  
PS51340  MOSC  
Amino Acid Sequences MDITKFRANIIISGSPSPYDEDYWGGLTFSSNSDPNSSSASPKEILLTANCGRCVSLNVDHETGTPATKEKEVLKLLMKDRRVDEGMKYSPIFGRYGFLGNGDMDEGKVLRVGDAVNPESRKNKKKPPTASNLCAFSVTIPILYMQHASAYHPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.22
4 0.23
5 0.19
6 0.17
7 0.16
8 0.16
9 0.16
10 0.18
11 0.17
12 0.14
13 0.12
14 0.11
15 0.11
16 0.11
17 0.12
18 0.12
19 0.13
20 0.15
21 0.16
22 0.17
23 0.21
24 0.2
25 0.2
26 0.2
27 0.23
28 0.21
29 0.2
30 0.2
31 0.15
32 0.16
33 0.14
34 0.19
35 0.19
36 0.21
37 0.21
38 0.19
39 0.19
40 0.18
41 0.19
42 0.17
43 0.19
44 0.2
45 0.22
46 0.23
47 0.23
48 0.23
49 0.22
50 0.19
51 0.13
52 0.1
53 0.09
54 0.1
55 0.1
56 0.12
57 0.11
58 0.16
59 0.17
60 0.19
61 0.21
62 0.24
63 0.28
64 0.31
65 0.31
66 0.28
67 0.28
68 0.3
69 0.28
70 0.24
71 0.22
72 0.23
73 0.23
74 0.23
75 0.22
76 0.19
77 0.19
78 0.19
79 0.18
80 0.12
81 0.12
82 0.1
83 0.12
84 0.11
85 0.1
86 0.1
87 0.09
88 0.09
89 0.09
90 0.08
91 0.06
92 0.06
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.09
101 0.13
102 0.15
103 0.18
104 0.19
105 0.22
106 0.29
107 0.37
108 0.45
109 0.49
110 0.58
111 0.63
112 0.72
113 0.79
114 0.81
115 0.83
116 0.83
117 0.82
118 0.77
119 0.71
120 0.62
121 0.52
122 0.43
123 0.32
124 0.26
125 0.2
126 0.14
127 0.1
128 0.11
129 0.11
130 0.12
131 0.12
132 0.09
133 0.11
134 0.12