Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1L1Q6

Protein Details
Accession A0A4Z1L1Q6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-33LQVGGKDNVKRKERKKARKKEEMKLQNLNSHydrophilic
NLS Segment(s)
PositionSequence
12-24VKRKERKKARKKE
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MCMLQVGGKDNVKRKERKKARKKEEMKLQNLNSKAFLSFPSLQQAIILNHISDVSLTPHQELRGTLDDDFPSQQKNTKSKQLQSTADTSLNPGNQPAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.75
4 0.82
5 0.85
6 0.87
7 0.89
8 0.91
9 0.91
10 0.9
11 0.9
12 0.88
13 0.84
14 0.82
15 0.76
16 0.71
17 0.65
18 0.56
19 0.46
20 0.37
21 0.29
22 0.21
23 0.18
24 0.18
25 0.17
26 0.17
27 0.19
28 0.19
29 0.18
30 0.18
31 0.19
32 0.13
33 0.14
34 0.13
35 0.09
36 0.09
37 0.09
38 0.08
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.11
46 0.11
47 0.12
48 0.12
49 0.14
50 0.16
51 0.18
52 0.17
53 0.18
54 0.19
55 0.19
56 0.2
57 0.16
58 0.15
59 0.15
60 0.19
61 0.25
62 0.31
63 0.35
64 0.44
65 0.51
66 0.56
67 0.64
68 0.67
69 0.65
70 0.62
71 0.61
72 0.54
73 0.49
74 0.42
75 0.36
76 0.32
77 0.29
78 0.25