Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K634

Protein Details
Accession A0A4Z1K634   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-58PKKTAPPPPSPPKPKSKSKPKPRPGRIIIHFVBasic
180-200GYVGGRWRRSREQRERSVRVLHydrophilic
NLS Segment(s)
PositionSequence
22-52KHQPAPKKTAPPPPSPPKPKSKSKPKPRPGR
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013078  His_Pase_superF_clade-1  
IPR029033  His_PPase_superfam  
Pfam View protein in Pfam  
PF00300  His_Phos_1  
CDD cd07067  HP_PGM_like  
Amino Acid Sequences MGFWSRKSSPPPTSQRGGVNSKHQPAPKKTAPPPPSPPKPKSKSKPKPRPGRIIIHFVRHAEGYNNLRTPGAGNLTDPLLTPHGKSQCLTLRTQFSRLKPQHILCSPLRRTLQTALLSLPRTRIPITVDPELREYGSVPNCTGTPIGELKRKHEGVKMGFEIDFERVNEGWERNRERDGGYVGGRWRRSREQRERSVRVLERLWELGRERLEKKEGDVEILVISHGEFLHGLTGDYWHNADIISLTMIKTYRGYGFVDPPIRFAYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.63
4 0.62
5 0.57
6 0.57
7 0.58
8 0.6
9 0.61
10 0.59
11 0.61
12 0.62
13 0.66
14 0.65
15 0.67
16 0.68
17 0.73
18 0.74
19 0.73
20 0.76
21 0.76
22 0.79
23 0.79
24 0.78
25 0.78
26 0.8
27 0.82
28 0.83
29 0.84
30 0.85
31 0.87
32 0.91
33 0.9
34 0.94
35 0.92
36 0.93
37 0.88
38 0.87
39 0.8
40 0.79
41 0.72
42 0.67
43 0.61
44 0.51
45 0.45
46 0.35
47 0.31
48 0.23
49 0.26
50 0.23
51 0.26
52 0.26
53 0.25
54 0.24
55 0.23
56 0.23
57 0.2
58 0.19
59 0.14
60 0.13
61 0.14
62 0.15
63 0.15
64 0.13
65 0.12
66 0.11
67 0.11
68 0.12
69 0.16
70 0.19
71 0.2
72 0.2
73 0.24
74 0.28
75 0.3
76 0.31
77 0.3
78 0.35
79 0.36
80 0.43
81 0.42
82 0.39
83 0.47
84 0.47
85 0.49
86 0.47
87 0.48
88 0.49
89 0.45
90 0.48
91 0.4
92 0.48
93 0.43
94 0.43
95 0.42
96 0.35
97 0.36
98 0.33
99 0.36
100 0.28
101 0.27
102 0.22
103 0.24
104 0.24
105 0.21
106 0.2
107 0.15
108 0.15
109 0.15
110 0.15
111 0.16
112 0.2
113 0.24
114 0.28
115 0.28
116 0.27
117 0.28
118 0.27
119 0.23
120 0.17
121 0.14
122 0.13
123 0.15
124 0.14
125 0.13
126 0.13
127 0.13
128 0.14
129 0.13
130 0.09
131 0.08
132 0.11
133 0.14
134 0.19
135 0.2
136 0.23
137 0.3
138 0.31
139 0.3
140 0.31
141 0.34
142 0.31
143 0.36
144 0.34
145 0.28
146 0.26
147 0.25
148 0.22
149 0.17
150 0.15
151 0.1
152 0.11
153 0.1
154 0.11
155 0.13
156 0.14
157 0.17
158 0.23
159 0.27
160 0.27
161 0.29
162 0.29
163 0.28
164 0.29
165 0.27
166 0.23
167 0.2
168 0.21
169 0.23
170 0.28
171 0.3
172 0.29
173 0.32
174 0.38
175 0.48
176 0.55
177 0.63
178 0.67
179 0.75
180 0.83
181 0.83
182 0.77
183 0.76
184 0.68
185 0.62
186 0.54
187 0.45
188 0.38
189 0.36
190 0.32
191 0.27
192 0.25
193 0.25
194 0.27
195 0.3
196 0.29
197 0.31
198 0.35
199 0.32
200 0.33
201 0.36
202 0.32
203 0.3
204 0.28
205 0.24
206 0.2
207 0.19
208 0.16
209 0.09
210 0.08
211 0.06
212 0.06
213 0.06
214 0.05
215 0.05
216 0.08
217 0.08
218 0.08
219 0.08
220 0.1
221 0.1
222 0.12
223 0.12
224 0.1
225 0.1
226 0.09
227 0.09
228 0.08
229 0.08
230 0.08
231 0.09
232 0.08
233 0.11
234 0.11
235 0.12
236 0.13
237 0.15
238 0.15
239 0.17
240 0.2
241 0.22
242 0.27
243 0.33
244 0.39
245 0.37
246 0.37