Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KN47

Protein Details
Accession A0A4Z1KN47    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-84KTDVSKPKKDDKCKSCEKKKQKEEKKKEKKSSAGGCMVSBasic
NLS Segment(s)
PositionSequence
62-76EKKKQKEEKKKEKKS
Subcellular Location(s) nucl 15.5, mito_nucl 11.5, mito 6.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPADWRTDKSGNVKGIIRRKGDPNPLNWGYKVDDSVLSHPKADMIKTDVSKPKKDDKCKSCEKKKQKEEKKKEKKSSAGGCMVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.54
4 0.51
5 0.47
6 0.51
7 0.54
8 0.6
9 0.56
10 0.51
11 0.53
12 0.53
13 0.51
14 0.45
15 0.4
16 0.32
17 0.29
18 0.26
19 0.18
20 0.16
21 0.15
22 0.19
23 0.22
24 0.19
25 0.19
26 0.18
27 0.19
28 0.17
29 0.16
30 0.13
31 0.12
32 0.15
33 0.16
34 0.22
35 0.27
36 0.3
37 0.34
38 0.37
39 0.44
40 0.49
41 0.58
42 0.63
43 0.63
44 0.68
45 0.75
46 0.82
47 0.82
48 0.84
49 0.86
50 0.87
51 0.9
52 0.93
53 0.93
54 0.94
55 0.95
56 0.95
57 0.96
58 0.96
59 0.95
60 0.94
61 0.91
62 0.89
63 0.87
64 0.84