Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1L0H1

Protein Details
Accession A0A4Z1L0H1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
184-207VIYFCFKKRRKADMQFMKKAKKKFHydrophilic
NLS Segment(s)
PositionSequence
191-195KRRKA
200-205MKKAKK
Subcellular Location(s) cyto 10.5, cyto_nucl 8, mito 7, nucl 4.5, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MTTSRSPSPEFSPLAIGIDLAPLPTYKAATTSTVNFSGLLEPPLKLHEDLSKGCGGQLWPAGMVLAQHMLRYHKDILKDAKILELGAGGGLVGLAVALACDLQHPLVLSDMEVMYELMKQNIALNEVSSKVEPLILNWGEPLPELVVKDKPDVILAADCVYFEPAFPLLLQTLEELLGLSQNAVIYFCFKKRRKADMQFMKKAKKKFLVEEIEDQDRETFTREGLFLYTFKRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.21
4 0.14
5 0.14
6 0.12
7 0.09
8 0.09
9 0.07
10 0.08
11 0.09
12 0.1
13 0.08
14 0.11
15 0.12
16 0.15
17 0.18
18 0.21
19 0.24
20 0.24
21 0.24
22 0.23
23 0.21
24 0.21
25 0.19
26 0.17
27 0.14
28 0.13
29 0.13
30 0.15
31 0.16
32 0.14
33 0.14
34 0.17
35 0.21
36 0.22
37 0.24
38 0.24
39 0.22
40 0.22
41 0.22
42 0.17
43 0.16
44 0.16
45 0.14
46 0.12
47 0.12
48 0.12
49 0.1
50 0.09
51 0.07
52 0.08
53 0.07
54 0.08
55 0.09
56 0.11
57 0.12
58 0.16
59 0.2
60 0.2
61 0.22
62 0.26
63 0.31
64 0.33
65 0.34
66 0.3
67 0.27
68 0.25
69 0.23
70 0.18
71 0.12
72 0.08
73 0.06
74 0.05
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.01
81 0.01
82 0.01
83 0.01
84 0.01
85 0.01
86 0.02
87 0.02
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.08
116 0.08
117 0.06
118 0.09
119 0.08
120 0.08
121 0.14
122 0.13
123 0.13
124 0.13
125 0.13
126 0.11
127 0.11
128 0.11
129 0.05
130 0.06
131 0.07
132 0.08
133 0.11
134 0.12
135 0.13
136 0.14
137 0.13
138 0.13
139 0.12
140 0.12
141 0.1
142 0.09
143 0.09
144 0.08
145 0.08
146 0.08
147 0.09
148 0.07
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.07
156 0.07
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.05
164 0.06
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.06
172 0.09
173 0.12
174 0.17
175 0.27
176 0.3
177 0.4
178 0.48
179 0.58
180 0.64
181 0.72
182 0.78
183 0.79
184 0.86
185 0.86
186 0.86
187 0.86
188 0.82
189 0.78
190 0.76
191 0.73
192 0.69
193 0.66
194 0.68
195 0.67
196 0.66
197 0.68
198 0.65
199 0.61
200 0.55
201 0.49
202 0.4
203 0.32
204 0.27
205 0.23
206 0.18
207 0.13
208 0.16
209 0.16
210 0.16
211 0.17
212 0.19
213 0.16
214 0.22