Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E1B1

Protein Details
Accession A5E1B1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
421-442YNEIRGYKRKLKKQTSRFGFNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014842  AFT  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0036086  P:positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation  
KEGG lel:LELG_03398  -  
Pfam View protein in Pfam  
PF08731  AFT  
Amino Acid Sequences MSLQEDDFTSNIDEQLLSSVDPHGVKLKLEEIAHAAALSSQNSQQHSPEASAAQFDAGALQTQHQHQHQNQDQDQIQNQNQNLNHNQNQDQEQEHDQKASRRNRISSKEKNVVNAANQDDFRQFQLQQQLQLQQQQHHQQQQQQHQQIEQDFNRQQQQQLQHHAQQQAVAAVGLNNYTHSQQHQQQQQQFQHHQQQQLQHHHQHQHQHQHHQIPELQGPTAEELSEYNIQIPEPIIDAKLKIFPVTENTITAEGNLITRPYPEQIFNDRDGLNEFIAEFARDNGFGIVIAHSNKKAIYYTCELGGRYRHKKSKKIDVSKQIDVGDGYMLDPDTKTKKLKCPFSMTASFKKSTGMWTLRTTCNEHNHPQLDPLLNHPMLRKRSDELNLVILELYKLGTKPSHIESKIRSQYPDVMIKREDIYNEIRGYKRKLKKQTSRFGFNNPSRIANAQYRKKAAQQAAAAAAAASAAANAVVVGGEVGAHGTGSSAPDNNPGVVDLPSSSNNDASDQVSGLSLGVSGVQGTNEVDPVAAVTAAANANAFLQGDGQELQYDPYQQHQQHQQFQPQQLHQQSQQQQQQQQQQEQQEHQEHQEHQELSQSTNQQQQQQQEEFQRQFVAATQLDEQQYQQYQQHLQEHGLQDNDNAATAAAIAAARHHYADSADLSMDNIDSRLVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.13
4 0.1
5 0.1
6 0.11
7 0.14
8 0.15
9 0.16
10 0.19
11 0.19
12 0.2
13 0.21
14 0.23
15 0.24
16 0.25
17 0.25
18 0.23
19 0.23
20 0.22
21 0.2
22 0.16
23 0.14
24 0.15
25 0.15
26 0.14
27 0.15
28 0.2
29 0.23
30 0.25
31 0.24
32 0.27
33 0.28
34 0.28
35 0.27
36 0.25
37 0.23
38 0.22
39 0.21
40 0.16
41 0.14
42 0.12
43 0.1
44 0.08
45 0.1
46 0.09
47 0.1
48 0.14
49 0.17
50 0.23
51 0.25
52 0.33
53 0.35
54 0.46
55 0.51
56 0.57
57 0.56
58 0.58
59 0.57
60 0.54
61 0.55
62 0.52
63 0.49
64 0.46
65 0.44
66 0.43
67 0.42
68 0.43
69 0.46
70 0.46
71 0.48
72 0.47
73 0.49
74 0.48
75 0.5
76 0.46
77 0.42
78 0.37
79 0.39
80 0.4
81 0.38
82 0.37
83 0.37
84 0.41
85 0.47
86 0.53
87 0.55
88 0.55
89 0.62
90 0.67
91 0.73
92 0.77
93 0.78
94 0.78
95 0.77
96 0.72
97 0.69
98 0.65
99 0.59
100 0.53
101 0.48
102 0.42
103 0.37
104 0.36
105 0.33
106 0.3
107 0.28
108 0.27
109 0.24
110 0.21
111 0.22
112 0.32
113 0.32
114 0.34
115 0.37
116 0.39
117 0.38
118 0.44
119 0.42
120 0.36
121 0.42
122 0.46
123 0.49
124 0.52
125 0.54
126 0.53
127 0.59
128 0.65
129 0.68
130 0.66
131 0.61
132 0.54
133 0.55
134 0.53
135 0.52
136 0.43
137 0.42
138 0.38
139 0.4
140 0.44
141 0.41
142 0.39
143 0.38
144 0.46
145 0.44
146 0.5
147 0.52
148 0.52
149 0.56
150 0.57
151 0.51
152 0.42
153 0.36
154 0.28
155 0.23
156 0.16
157 0.1
158 0.08
159 0.08
160 0.07
161 0.06
162 0.06
163 0.07
164 0.09
165 0.1
166 0.12
167 0.18
168 0.23
169 0.31
170 0.39
171 0.45
172 0.51
173 0.58
174 0.62
175 0.64
176 0.63
177 0.62
178 0.64
179 0.61
180 0.6
181 0.55
182 0.58
183 0.58
184 0.63
185 0.63
186 0.59
187 0.61
188 0.62
189 0.62
190 0.63
191 0.62
192 0.63
193 0.61
194 0.64
195 0.63
196 0.64
197 0.61
198 0.56
199 0.52
200 0.44
201 0.42
202 0.34
203 0.28
204 0.21
205 0.2
206 0.18
207 0.15
208 0.11
209 0.08
210 0.07
211 0.11
212 0.12
213 0.12
214 0.11
215 0.11
216 0.11
217 0.12
218 0.12
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.09
226 0.12
227 0.12
228 0.11
229 0.11
230 0.11
231 0.15
232 0.19
233 0.18
234 0.16
235 0.17
236 0.18
237 0.17
238 0.16
239 0.13
240 0.08
241 0.08
242 0.08
243 0.07
244 0.06
245 0.07
246 0.08
247 0.09
248 0.1
249 0.12
250 0.15
251 0.21
252 0.24
253 0.25
254 0.27
255 0.25
256 0.24
257 0.24
258 0.22
259 0.16
260 0.13
261 0.11
262 0.08
263 0.08
264 0.08
265 0.06
266 0.06
267 0.06
268 0.06
269 0.07
270 0.06
271 0.06
272 0.05
273 0.06
274 0.05
275 0.06
276 0.08
277 0.09
278 0.09
279 0.09
280 0.09
281 0.1
282 0.11
283 0.1
284 0.13
285 0.16
286 0.17
287 0.18
288 0.2
289 0.19
290 0.2
291 0.25
292 0.29
293 0.32
294 0.38
295 0.44
296 0.49
297 0.57
298 0.61
299 0.66
300 0.69
301 0.71
302 0.73
303 0.75
304 0.76
305 0.69
306 0.66
307 0.55
308 0.45
309 0.35
310 0.27
311 0.16
312 0.1
313 0.08
314 0.05
315 0.05
316 0.04
317 0.04
318 0.06
319 0.09
320 0.12
321 0.16
322 0.19
323 0.27
324 0.34
325 0.42
326 0.44
327 0.5
328 0.5
329 0.53
330 0.57
331 0.53
332 0.53
333 0.49
334 0.46
335 0.37
336 0.35
337 0.29
338 0.24
339 0.26
340 0.22
341 0.21
342 0.24
343 0.28
344 0.3
345 0.32
346 0.33
347 0.31
348 0.35
349 0.37
350 0.36
351 0.38
352 0.37
353 0.35
354 0.32
355 0.31
356 0.26
357 0.22
358 0.22
359 0.21
360 0.2
361 0.21
362 0.22
363 0.25
364 0.26
365 0.28
366 0.27
367 0.23
368 0.28
369 0.31
370 0.31
371 0.26
372 0.27
373 0.24
374 0.23
375 0.2
376 0.15
377 0.12
378 0.09
379 0.08
380 0.05
381 0.05
382 0.06
383 0.06
384 0.07
385 0.1
386 0.14
387 0.21
388 0.22
389 0.25
390 0.28
391 0.38
392 0.43
393 0.42
394 0.4
395 0.34
396 0.38
397 0.39
398 0.44
399 0.35
400 0.32
401 0.31
402 0.31
403 0.31
404 0.26
405 0.22
406 0.17
407 0.19
408 0.2
409 0.21
410 0.23
411 0.24
412 0.26
413 0.33
414 0.39
415 0.44
416 0.49
417 0.58
418 0.65
419 0.73
420 0.8
421 0.84
422 0.82
423 0.82
424 0.76
425 0.73
426 0.72
427 0.65
428 0.63
429 0.54
430 0.48
431 0.4
432 0.39
433 0.36
434 0.34
435 0.39
436 0.39
437 0.43
438 0.45
439 0.45
440 0.49
441 0.53
442 0.48
443 0.45
444 0.39
445 0.37
446 0.34
447 0.32
448 0.27
449 0.19
450 0.15
451 0.08
452 0.07
453 0.04
454 0.02
455 0.02
456 0.02
457 0.02
458 0.02
459 0.02
460 0.02
461 0.02
462 0.02
463 0.02
464 0.02
465 0.02
466 0.02
467 0.02
468 0.02
469 0.02
470 0.03
471 0.03
472 0.05
473 0.06
474 0.07
475 0.08
476 0.12
477 0.13
478 0.13
479 0.13
480 0.12
481 0.12
482 0.11
483 0.11
484 0.08
485 0.1
486 0.12
487 0.14
488 0.14
489 0.14
490 0.15
491 0.16
492 0.16
493 0.15
494 0.14
495 0.11
496 0.11
497 0.1
498 0.09
499 0.08
500 0.06
501 0.05
502 0.04
503 0.04
504 0.04
505 0.04
506 0.04
507 0.04
508 0.05
509 0.06
510 0.06
511 0.06
512 0.06
513 0.06
514 0.05
515 0.06
516 0.06
517 0.05
518 0.04
519 0.04
520 0.06
521 0.06
522 0.06
523 0.06
524 0.06
525 0.06
526 0.07
527 0.07
528 0.05
529 0.06
530 0.06
531 0.08
532 0.09
533 0.09
534 0.09
535 0.09
536 0.11
537 0.11
538 0.12
539 0.11
540 0.16
541 0.24
542 0.24
543 0.31
544 0.39
545 0.46
546 0.54
547 0.59
548 0.63
549 0.62
550 0.68
551 0.69
552 0.63
553 0.64
554 0.6
555 0.59
556 0.53
557 0.56
558 0.56
559 0.58
560 0.62
561 0.6
562 0.61
563 0.64
564 0.69
565 0.67
566 0.66
567 0.64
568 0.64
569 0.63
570 0.6
571 0.6
572 0.57
573 0.52
574 0.49
575 0.49
576 0.44
577 0.43
578 0.47
579 0.39
580 0.33
581 0.38
582 0.34
583 0.31
584 0.34
585 0.34
586 0.29
587 0.37
588 0.4
589 0.4
590 0.44
591 0.48
592 0.51
593 0.5
594 0.53
595 0.53
596 0.59
597 0.53
598 0.5
599 0.44
600 0.36
601 0.32
602 0.29
603 0.28
604 0.2
605 0.2
606 0.21
607 0.24
608 0.25
609 0.26
610 0.24
611 0.23
612 0.25
613 0.26
614 0.27
615 0.27
616 0.3
617 0.36
618 0.42
619 0.38
620 0.38
621 0.42
622 0.43
623 0.41
624 0.38
625 0.32
626 0.26
627 0.28
628 0.25
629 0.19
630 0.15
631 0.11
632 0.09
633 0.09
634 0.08
635 0.06
636 0.06
637 0.05
638 0.07
639 0.1
640 0.11
641 0.11
642 0.12
643 0.12
644 0.12
645 0.15
646 0.16
647 0.15
648 0.14
649 0.14
650 0.14
651 0.14
652 0.14
653 0.11
654 0.09
655 0.08