Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E130

Protein Details
Accession A5E130    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
125-147LKAAPKKRTSYRRKRMKLYMPGNHydrophilic
NLS Segment(s)
PositionSequence
128-140APKKRTSYRRKRM
Subcellular Location(s) mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0016020  C:membrane  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lel:LELG_03317  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAQHRINKGYCPPNTHFNHHSPSAFFFSFFLFCFSTSAHMSLALRFGAVASLQESLLGALPRLPQISIRLGLSSLPLGQCKHELEHEHEHEHQQHMDPRLAELQEQLENSDSQSMPFMIDNGTILKAAPKKRTSYRRKRMKLYMPGNKQVQPLFNIVRCPACGAAKRSHFMCMNCFAEIKTFLKKLKREDGLIKDRELNPQKDISPVDERVIYPGKVESAHARELKKGEWIPKREEAVLYSREHMMKRKNKNRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.6
4 0.57
5 0.59
6 0.55
7 0.53
8 0.45
9 0.44
10 0.43
11 0.38
12 0.32
13 0.26
14 0.24
15 0.23
16 0.22
17 0.21
18 0.15
19 0.15
20 0.15
21 0.15
22 0.17
23 0.17
24 0.18
25 0.14
26 0.16
27 0.16
28 0.16
29 0.17
30 0.13
31 0.11
32 0.1
33 0.09
34 0.08
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.09
44 0.08
45 0.07
46 0.08
47 0.1
48 0.11
49 0.12
50 0.11
51 0.11
52 0.14
53 0.17
54 0.17
55 0.16
56 0.15
57 0.15
58 0.15
59 0.15
60 0.12
61 0.1
62 0.09
63 0.11
64 0.11
65 0.12
66 0.15
67 0.15
68 0.16
69 0.18
70 0.2
71 0.24
72 0.32
73 0.34
74 0.34
75 0.34
76 0.36
77 0.35
78 0.34
79 0.29
80 0.23
81 0.26
82 0.25
83 0.26
84 0.23
85 0.22
86 0.23
87 0.22
88 0.19
89 0.15
90 0.14
91 0.13
92 0.13
93 0.12
94 0.1
95 0.1
96 0.1
97 0.12
98 0.1
99 0.08
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.08
113 0.13
114 0.17
115 0.22
116 0.24
117 0.29
118 0.37
119 0.48
120 0.56
121 0.63
122 0.69
123 0.74
124 0.79
125 0.82
126 0.83
127 0.81
128 0.81
129 0.79
130 0.78
131 0.73
132 0.72
133 0.68
134 0.62
135 0.55
136 0.46
137 0.38
138 0.31
139 0.29
140 0.25
141 0.23
142 0.22
143 0.21
144 0.2
145 0.18
146 0.17
147 0.15
148 0.16
149 0.19
150 0.21
151 0.27
152 0.29
153 0.32
154 0.31
155 0.34
156 0.34
157 0.31
158 0.31
159 0.3
160 0.28
161 0.26
162 0.26
163 0.21
164 0.2
165 0.22
166 0.2
167 0.19
168 0.21
169 0.25
170 0.32
171 0.36
172 0.41
173 0.47
174 0.49
175 0.49
176 0.54
177 0.59
178 0.61
179 0.59
180 0.54
181 0.51
182 0.49
183 0.54
184 0.53
185 0.46
186 0.39
187 0.4
188 0.39
189 0.37
190 0.37
191 0.33
192 0.31
193 0.3
194 0.29
195 0.28
196 0.27
197 0.28
198 0.31
199 0.26
200 0.21
201 0.2
202 0.19
203 0.18
204 0.2
205 0.22
206 0.22
207 0.29
208 0.33
209 0.33
210 0.36
211 0.38
212 0.37
213 0.39
214 0.4
215 0.42
216 0.46
217 0.51
218 0.53
219 0.57
220 0.6
221 0.54
222 0.51
223 0.44
224 0.42
225 0.41
226 0.37
227 0.32
228 0.33
229 0.34
230 0.36
231 0.4
232 0.44
233 0.49
234 0.58