Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K5K6

Protein Details
Accession A0A4Z1K5K6    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-92ESAEAPRRKKPRRAAPDPELEDBasic
95-119EHSPARRQSARPPSRRSRRQAEARKBasic
NLS Segment(s)
PositionSequence
76-86PRRKKPRRAAP
98-119PARRQSARPPSRRSRRQAEARK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MERGYGDKSYFVAGDNSGGQGNEPEPDVEGNIEPISSGDDEIRDSPGPGHGESLTVSRKRPRMPDHDDDQESAEAPRRKKPRRAAPDPELEDDPEHSPARRQSARPPSRRSRRQAEARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.12
5 0.12
6 0.11
7 0.11
8 0.11
9 0.09
10 0.09
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.09
19 0.08
20 0.07
21 0.07
22 0.08
23 0.07
24 0.07
25 0.06
26 0.07
27 0.08
28 0.09
29 0.11
30 0.1
31 0.1
32 0.1
33 0.13
34 0.14
35 0.13
36 0.14
37 0.11
38 0.12
39 0.12
40 0.14
41 0.15
42 0.15
43 0.17
44 0.2
45 0.24
46 0.27
47 0.33
48 0.36
49 0.41
50 0.47
51 0.52
52 0.52
53 0.55
54 0.53
55 0.47
56 0.43
57 0.34
58 0.27
59 0.21
60 0.22
61 0.2
62 0.21
63 0.28
64 0.36
65 0.43
66 0.52
67 0.62
68 0.66
69 0.72
70 0.8
71 0.81
72 0.78
73 0.81
74 0.76
75 0.7
76 0.6
77 0.51
78 0.42
79 0.35
80 0.3
81 0.24
82 0.21
83 0.18
84 0.21
85 0.24
86 0.32
87 0.36
88 0.37
89 0.43
90 0.54
91 0.63
92 0.68
93 0.73
94 0.75
95 0.81
96 0.88
97 0.86
98 0.84
99 0.85