Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1L3G3

Protein Details
Accession A0A4Z1L3G3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-90EKMDQYAKEKKEKKKKEVQAGMRKSBasic
NLS Segment(s)
PositionSequence
73-90KEKKEKKKKEVQAGMRKS
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MFSNRSSGSGNPTGSRNKENETKEEQNKRDDAAMEAIVMKPTIQSGLRNREKSMNPNSPGKKIVQEKMDQYAKEKKEKKKKEVQAGMRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.37
4 0.37
5 0.43
6 0.44
7 0.46
8 0.48
9 0.53
10 0.58
11 0.64
12 0.62
13 0.59
14 0.57
15 0.52
16 0.45
17 0.37
18 0.3
19 0.23
20 0.2
21 0.14
22 0.14
23 0.13
24 0.1
25 0.09
26 0.07
27 0.05
28 0.05
29 0.06
30 0.06
31 0.1
32 0.15
33 0.25
34 0.32
35 0.33
36 0.35
37 0.4
38 0.42
39 0.45
40 0.48
41 0.47
42 0.43
43 0.51
44 0.52
45 0.49
46 0.48
47 0.43
48 0.42
49 0.39
50 0.42
51 0.38
52 0.39
53 0.39
54 0.45
55 0.49
56 0.41
57 0.4
58 0.44
59 0.44
60 0.5
61 0.56
62 0.59
63 0.65
64 0.75
65 0.79
66 0.81
67 0.86
68 0.87
69 0.89
70 0.9