Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KDZ2

Protein Details
Accession A0A4Z1KDZ2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-133DGTSWLPKLSRKQRQIKKQWYRAAVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MEDHPYSLPIKTNDAKIEVQNVLSKNKVDLRPASDTHSDQNTSLDSSKPHPPLAIAESAAASMNDAPQSENSLRHDNKDQRDSAGGTRINPHKKPNGRVLYCDILDPDGTSWLPKLSRKQRQIKKQWYRAAVEAKKATNEMLAAAEVAENSEMRDAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.35
4 0.38
5 0.32
6 0.3
7 0.3
8 0.29
9 0.28
10 0.27
11 0.26
12 0.25
13 0.31
14 0.32
15 0.32
16 0.34
17 0.36
18 0.4
19 0.41
20 0.42
21 0.38
22 0.37
23 0.37
24 0.37
25 0.32
26 0.27
27 0.27
28 0.22
29 0.2
30 0.2
31 0.17
32 0.15
33 0.17
34 0.24
35 0.25
36 0.25
37 0.22
38 0.22
39 0.23
40 0.24
41 0.22
42 0.15
43 0.13
44 0.13
45 0.13
46 0.12
47 0.09
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.1
56 0.11
57 0.13
58 0.16
59 0.23
60 0.23
61 0.25
62 0.33
63 0.35
64 0.39
65 0.42
66 0.39
67 0.32
68 0.34
69 0.33
70 0.26
71 0.26
72 0.22
73 0.18
74 0.23
75 0.29
76 0.33
77 0.34
78 0.37
79 0.4
80 0.46
81 0.5
82 0.54
83 0.57
84 0.52
85 0.53
86 0.54
87 0.49
88 0.43
89 0.39
90 0.29
91 0.2
92 0.19
93 0.16
94 0.11
95 0.08
96 0.08
97 0.08
98 0.08
99 0.09
100 0.12
101 0.16
102 0.25
103 0.34
104 0.44
105 0.54
106 0.64
107 0.71
108 0.8
109 0.87
110 0.89
111 0.89
112 0.89
113 0.88
114 0.83
115 0.77
116 0.73
117 0.73
118 0.65
119 0.62
120 0.57
121 0.51
122 0.47
123 0.44
124 0.37
125 0.28
126 0.24
127 0.17
128 0.13
129 0.12
130 0.1
131 0.09
132 0.09
133 0.07
134 0.08
135 0.07
136 0.06
137 0.07