Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KTV4

Protein Details
Accession A0A4Z1KTV4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
151-198IRKVMVRKRLRPDSNDKKNGIVKRNIRNAKGKGRKGRKGSKKGDFDSMBasic
NLS Segment(s)
PositionSequence
153-192KVMVRKRLRPDSNDKKNGIVKRNIRNAKGKGRKGRKGSKK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Amino Acid Sequences MKPIKPSNVSSSSSSTNFFSFTSDPPSNISIPPAIYTNNALNNSNSTPPTLPSISTILQQPLLPLPITSTRTHNPITRLSTRNPASSAAVVSNTSTTTRGLVATQRTKIIKTFVSPKGCTKIILMITITTMQEPFFDKEKNSWVMRRTTEIRKVMVRKRLRPDSNDKKNGIVKRNIRNAKGKGRKGRKGSKKGDFDSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.28
4 0.26
5 0.22
6 0.21
7 0.19
8 0.19
9 0.25
10 0.25
11 0.24
12 0.26
13 0.29
14 0.27
15 0.25
16 0.25
17 0.18
18 0.18
19 0.18
20 0.17
21 0.15
22 0.14
23 0.17
24 0.18
25 0.22
26 0.23
27 0.23
28 0.23
29 0.25
30 0.26
31 0.27
32 0.23
33 0.2
34 0.19
35 0.19
36 0.23
37 0.2
38 0.18
39 0.17
40 0.2
41 0.19
42 0.19
43 0.2
44 0.17
45 0.17
46 0.16
47 0.15
48 0.13
49 0.13
50 0.12
51 0.09
52 0.11
53 0.15
54 0.18
55 0.18
56 0.22
57 0.22
58 0.26
59 0.29
60 0.3
61 0.28
62 0.3
63 0.35
64 0.37
65 0.38
66 0.37
67 0.43
68 0.42
69 0.4
70 0.36
71 0.31
72 0.26
73 0.23
74 0.21
75 0.13
76 0.12
77 0.1
78 0.09
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.1
89 0.15
90 0.18
91 0.19
92 0.22
93 0.22
94 0.22
95 0.23
96 0.22
97 0.18
98 0.17
99 0.24
100 0.28
101 0.33
102 0.34
103 0.36
104 0.38
105 0.37
106 0.35
107 0.28
108 0.26
109 0.21
110 0.21
111 0.18
112 0.14
113 0.14
114 0.14
115 0.14
116 0.09
117 0.08
118 0.07
119 0.07
120 0.1
121 0.12
122 0.14
123 0.15
124 0.16
125 0.18
126 0.24
127 0.28
128 0.28
129 0.3
130 0.31
131 0.36
132 0.37
133 0.41
134 0.41
135 0.44
136 0.5
137 0.49
138 0.48
139 0.5
140 0.56
141 0.57
142 0.61
143 0.62
144 0.62
145 0.68
146 0.75
147 0.74
148 0.73
149 0.77
150 0.78
151 0.81
152 0.8
153 0.72
154 0.68
155 0.69
156 0.7
157 0.67
158 0.65
159 0.63
160 0.65
161 0.74
162 0.74
163 0.73
164 0.75
165 0.75
166 0.76
167 0.78
168 0.78
169 0.78
170 0.81
171 0.85
172 0.86
173 0.89
174 0.88
175 0.89
176 0.89
177 0.89
178 0.88