Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KIE7

Protein Details
Accession A0A4Z1KIE7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
245-269FEKMRIRDGKPKSKHREEMEKQWASBasic
NLS Segment(s)
PositionSequence
141-152GVKPPKKPKVSK
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 11, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MSGTVAKQPLDVADSNIKTPPAPILPPPKSKDKALVKTPASKTATDNKRKASEIEEQQDLAEIDSDDERLHIVDQNCDQIRRKIRTFLESGEMKVTEFQKKTGTNSRSYGAFMGQSGKFKGDQSNVYLNAFIYFKKRELQGVKPPKKPKVSKAEEQKKFDVSAIKLDGESTTSVPIYDSCDEIRKKIRAFLREPGVTQAAFLREIAKTYPEEKKIQSKVLNDFLGKKGPSAGNTSSTYYAAYVFFEKMRIRDGKPKSKHREEMEKQWASEGGVDTKTPSSRGYFCFGDERPVEDKYGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.3
4 0.29
5 0.24
6 0.25
7 0.25
8 0.21
9 0.22
10 0.28
11 0.36
12 0.43
13 0.51
14 0.55
15 0.6
16 0.59
17 0.59
18 0.62
19 0.62
20 0.64
21 0.63
22 0.68
23 0.62
24 0.68
25 0.68
26 0.68
27 0.6
28 0.53
29 0.49
30 0.51
31 0.56
32 0.57
33 0.59
34 0.57
35 0.59
36 0.59
37 0.57
38 0.51
39 0.5
40 0.49
41 0.49
42 0.44
43 0.39
44 0.37
45 0.37
46 0.32
47 0.23
48 0.15
49 0.1
50 0.09
51 0.09
52 0.1
53 0.08
54 0.08
55 0.08
56 0.07
57 0.08
58 0.11
59 0.12
60 0.15
61 0.17
62 0.24
63 0.26
64 0.28
65 0.3
66 0.33
67 0.41
68 0.44
69 0.45
70 0.46
71 0.48
72 0.5
73 0.5
74 0.44
75 0.42
76 0.37
77 0.35
78 0.3
79 0.26
80 0.21
81 0.22
82 0.23
83 0.23
84 0.22
85 0.23
86 0.26
87 0.27
88 0.33
89 0.39
90 0.39
91 0.37
92 0.38
93 0.39
94 0.34
95 0.33
96 0.28
97 0.2
98 0.16
99 0.12
100 0.15
101 0.14
102 0.15
103 0.14
104 0.15
105 0.15
106 0.16
107 0.19
108 0.18
109 0.18
110 0.21
111 0.25
112 0.25
113 0.24
114 0.24
115 0.2
116 0.18
117 0.16
118 0.13
119 0.11
120 0.12
121 0.13
122 0.15
123 0.16
124 0.21
125 0.25
126 0.3
127 0.37
128 0.47
129 0.54
130 0.59
131 0.64
132 0.65
133 0.7
134 0.67
135 0.65
136 0.65
137 0.63
138 0.63
139 0.69
140 0.72
141 0.7
142 0.71
143 0.65
144 0.55
145 0.49
146 0.44
147 0.37
148 0.27
149 0.24
150 0.21
151 0.19
152 0.17
153 0.17
154 0.15
155 0.12
156 0.12
157 0.08
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.1
164 0.1
165 0.11
166 0.11
167 0.17
168 0.18
169 0.21
170 0.27
171 0.28
172 0.28
173 0.33
174 0.38
175 0.38
176 0.41
177 0.45
178 0.46
179 0.43
180 0.43
181 0.4
182 0.36
183 0.29
184 0.26
185 0.2
186 0.14
187 0.13
188 0.13
189 0.11
190 0.1
191 0.11
192 0.11
193 0.11
194 0.12
195 0.16
196 0.23
197 0.25
198 0.29
199 0.32
200 0.4
201 0.42
202 0.47
203 0.48
204 0.46
205 0.48
206 0.5
207 0.5
208 0.42
209 0.41
210 0.37
211 0.38
212 0.33
213 0.27
214 0.26
215 0.25
216 0.25
217 0.27
218 0.27
219 0.26
220 0.28
221 0.31
222 0.27
223 0.25
224 0.24
225 0.19
226 0.18
227 0.13
228 0.13
229 0.12
230 0.12
231 0.12
232 0.16
233 0.17
234 0.17
235 0.23
236 0.27
237 0.29
238 0.37
239 0.47
240 0.53
241 0.61
242 0.71
243 0.75
244 0.8
245 0.84
246 0.82
247 0.84
248 0.8
249 0.82
250 0.82
251 0.76
252 0.66
253 0.59
254 0.52
255 0.41
256 0.38
257 0.3
258 0.23
259 0.19
260 0.19
261 0.2
262 0.22
263 0.23
264 0.21
265 0.21
266 0.22
267 0.26
268 0.29
269 0.32
270 0.3
271 0.31
272 0.37
273 0.35
274 0.38
275 0.35
276 0.36
277 0.34
278 0.34
279 0.35