Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KX22

Protein Details
Accession A0A4Z1KX22   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
271-292AFETRKKREKAARDRDMQRKIABasic
346-370VAFAKKVKDDRGKKLERKLEKLEKEBasic
NLS Segment(s)
PositionSequence
204-300AEKERIRSEKEAKKREKAEEEKQRRILQEKKRKEQSIRAAAAFKERERLAKLEKERKEEERIEEEKNAFETRKKREKAARDRDMQRKIADKQARKAE
322-366HQKMAKAELSGREEESRKRARERAVAFAKKVKDDRGKKLERKLEK
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSIRSAAGSRAGSRASRRPVSVHHAVAPRPPSSASFISSRSRPESIHLGPIDVESDSHGARLSDGGSKIREEHRSTGPRTSTHHLPHYVFERISSHMQHLEDNLAHTRQEWGDGEIDPDDMLSRIANYRRGLDMVASPDACRNPSLKLRFDGVDDTLKELEEEANARKTRQEEGMEMTRKVAERRENGKREELERNQFLMQQKAEKERIRSEKEAKKREKAEEEKQRRILQEKKRKEQSIRAAAAFKERERLAKLEKERKEEERIEEEKNAFETRKKREKAARDRDMQRKIADKQARKAEEEARYQKKFTEEETRYVAKKTHQKMAKAELSGREEESRKRARERAVAFAKKVKDDRGKKLERKLEKLEKEISDVEEKLNHVADD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.46
4 0.47
5 0.47
6 0.51
7 0.55
8 0.56
9 0.51
10 0.5
11 0.5
12 0.49
13 0.52
14 0.5
15 0.42
16 0.36
17 0.34
18 0.29
19 0.3
20 0.31
21 0.27
22 0.26
23 0.29
24 0.33
25 0.35
26 0.38
27 0.36
28 0.36
29 0.34
30 0.35
31 0.4
32 0.37
33 0.42
34 0.37
35 0.33
36 0.31
37 0.31
38 0.27
39 0.19
40 0.16
41 0.1
42 0.11
43 0.1
44 0.1
45 0.11
46 0.1
47 0.1
48 0.11
49 0.1
50 0.13
51 0.15
52 0.18
53 0.19
54 0.2
55 0.24
56 0.29
57 0.34
58 0.34
59 0.37
60 0.44
61 0.5
62 0.52
63 0.56
64 0.53
65 0.49
66 0.51
67 0.51
68 0.5
69 0.48
70 0.51
71 0.48
72 0.46
73 0.47
74 0.46
75 0.44
76 0.36
77 0.32
78 0.27
79 0.26
80 0.28
81 0.26
82 0.24
83 0.23
84 0.24
85 0.24
86 0.23
87 0.22
88 0.19
89 0.2
90 0.2
91 0.16
92 0.16
93 0.15
94 0.17
95 0.14
96 0.17
97 0.15
98 0.14
99 0.15
100 0.15
101 0.16
102 0.14
103 0.14
104 0.1
105 0.09
106 0.08
107 0.06
108 0.06
109 0.05
110 0.05
111 0.09
112 0.12
113 0.17
114 0.18
115 0.2
116 0.21
117 0.21
118 0.21
119 0.18
120 0.18
121 0.16
122 0.17
123 0.15
124 0.14
125 0.16
126 0.16
127 0.16
128 0.15
129 0.13
130 0.15
131 0.22
132 0.27
133 0.27
134 0.29
135 0.31
136 0.3
137 0.31
138 0.29
139 0.23
140 0.23
141 0.2
142 0.2
143 0.17
144 0.16
145 0.15
146 0.13
147 0.11
148 0.08
149 0.09
150 0.09
151 0.15
152 0.16
153 0.16
154 0.18
155 0.19
156 0.21
157 0.24
158 0.24
159 0.19
160 0.24
161 0.31
162 0.31
163 0.3
164 0.28
165 0.25
166 0.24
167 0.23
168 0.23
169 0.21
170 0.26
171 0.33
172 0.42
173 0.46
174 0.47
175 0.52
176 0.49
177 0.47
178 0.49
179 0.47
180 0.43
181 0.4
182 0.39
183 0.34
184 0.36
185 0.33
186 0.28
187 0.23
188 0.21
189 0.22
190 0.25
191 0.31
192 0.3
193 0.32
194 0.36
195 0.43
196 0.45
197 0.48
198 0.52
199 0.54
200 0.61
201 0.68
202 0.66
203 0.66
204 0.66
205 0.67
206 0.67
207 0.67
208 0.67
209 0.68
210 0.71
211 0.71
212 0.71
213 0.68
214 0.61
215 0.6
216 0.59
217 0.59
218 0.61
219 0.63
220 0.67
221 0.72
222 0.76
223 0.74
224 0.74
225 0.73
226 0.72
227 0.66
228 0.58
229 0.51
230 0.46
231 0.48
232 0.41
233 0.31
234 0.27
235 0.24
236 0.25
237 0.26
238 0.29
239 0.27
240 0.33
241 0.41
242 0.46
243 0.5
244 0.54
245 0.56
246 0.57
247 0.59
248 0.55
249 0.51
250 0.5
251 0.49
252 0.45
253 0.45
254 0.41
255 0.35
256 0.33
257 0.3
258 0.23
259 0.26
260 0.3
261 0.36
262 0.45
263 0.46
264 0.52
265 0.58
266 0.68
267 0.73
268 0.77
269 0.76
270 0.75
271 0.82
272 0.84
273 0.82
274 0.75
275 0.67
276 0.63
277 0.57
278 0.58
279 0.58
280 0.55
281 0.56
282 0.62
283 0.61
284 0.57
285 0.58
286 0.56
287 0.54
288 0.57
289 0.58
290 0.57
291 0.57
292 0.54
293 0.53
294 0.51
295 0.45
296 0.41
297 0.42
298 0.37
299 0.39
300 0.45
301 0.47
302 0.43
303 0.43
304 0.41
305 0.38
306 0.44
307 0.45
308 0.48
309 0.49
310 0.54
311 0.58
312 0.64
313 0.63
314 0.56
315 0.55
316 0.53
317 0.51
318 0.48
319 0.44
320 0.4
321 0.37
322 0.39
323 0.44
324 0.46
325 0.47
326 0.52
327 0.56
328 0.58
329 0.64
330 0.63
331 0.64
332 0.66
333 0.67
334 0.64
335 0.65
336 0.61
337 0.59
338 0.59
339 0.58
340 0.58
341 0.6
342 0.67
343 0.7
344 0.77
345 0.78
346 0.84
347 0.84
348 0.83
349 0.83
350 0.83
351 0.82
352 0.78
353 0.77
354 0.74
355 0.66
356 0.62
357 0.57
358 0.5
359 0.45
360 0.39
361 0.35
362 0.31
363 0.3
364 0.28