Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E6B2

Protein Details
Accession A5E6B2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-37LERFDRLKRKRQETIKLNKIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG lel:LELG_05151  -  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MKMVEPQIEATYSNDLLERFDRLKRKRQETIKLNKIDAAQDSRRRQLVTISRAYQHLPNNNAYNSRADSKKDLTDLERAMEYTIEECEKWDKKQERKANHGIHDQVRLAESSYYKEIEKIPIDIEAYKAQKAELQNESHNAPAVELSDTTTQKSQGRSEPNSQDIKRSKIQKESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.17
5 0.2
6 0.18
7 0.25
8 0.34
9 0.39
10 0.49
11 0.56
12 0.63
13 0.68
14 0.74
15 0.79
16 0.79
17 0.84
18 0.84
19 0.79
20 0.71
21 0.65
22 0.57
23 0.49
24 0.42
25 0.38
26 0.36
27 0.4
28 0.44
29 0.45
30 0.46
31 0.44
32 0.41
33 0.42
34 0.43
35 0.41
36 0.43
37 0.41
38 0.4
39 0.4
40 0.42
41 0.38
42 0.35
43 0.34
44 0.31
45 0.32
46 0.34
47 0.34
48 0.34
49 0.31
50 0.28
51 0.25
52 0.26
53 0.23
54 0.22
55 0.25
56 0.25
57 0.26
58 0.25
59 0.24
60 0.22
61 0.25
62 0.23
63 0.2
64 0.17
65 0.15
66 0.14
67 0.13
68 0.1
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.11
75 0.13
76 0.14
77 0.22
78 0.29
79 0.36
80 0.46
81 0.53
82 0.54
83 0.61
84 0.69
85 0.67
86 0.64
87 0.61
88 0.56
89 0.51
90 0.47
91 0.39
92 0.3
93 0.24
94 0.2
95 0.16
96 0.13
97 0.11
98 0.11
99 0.13
100 0.13
101 0.13
102 0.14
103 0.15
104 0.18
105 0.18
106 0.17
107 0.16
108 0.16
109 0.17
110 0.16
111 0.17
112 0.17
113 0.18
114 0.18
115 0.17
116 0.16
117 0.19
118 0.2
119 0.24
120 0.24
121 0.26
122 0.27
123 0.3
124 0.31
125 0.28
126 0.28
127 0.22
128 0.17
129 0.14
130 0.12
131 0.11
132 0.1
133 0.12
134 0.16
135 0.17
136 0.19
137 0.2
138 0.23
139 0.25
140 0.28
141 0.3
142 0.32
143 0.41
144 0.44
145 0.51
146 0.55
147 0.58
148 0.64
149 0.6
150 0.62
151 0.59
152 0.6
153 0.59
154 0.62
155 0.61