Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1L595

Protein Details
Accession A0A4Z1L595    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-72KENFLTYKIKKKELKKKVDQHydrophilic
NLS Segment(s)
PositionSequence
62-68KKKELKK
Subcellular Location(s) mito 17.5, cyto_mito 10, nucl 8
Family & Domain DBs
Amino Acid Sequences MSLEKKLRLRAREAIVTWWCGGFCTQYTLELPPASRILVGEGDAKIEEKEMMKENFLTYKIKKKELKKKVDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.44
4 0.38
5 0.31
6 0.24
7 0.18
8 0.18
9 0.12
10 0.1
11 0.12
12 0.12
13 0.13
14 0.14
15 0.15
16 0.16
17 0.15
18 0.15
19 0.12
20 0.12
21 0.11
22 0.1
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.08
31 0.09
32 0.08
33 0.08
34 0.08
35 0.07
36 0.1
37 0.15
38 0.16
39 0.16
40 0.17
41 0.18
42 0.2
43 0.21
44 0.25
45 0.24
46 0.33
47 0.37
48 0.45
49 0.52
50 0.59
51 0.69
52 0.74