Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DVK0

Protein Details
Accession A5DVK0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-103REQHRQWYVADRKRRNKGAPKKKSSBasic
NLS Segment(s)
PositionSequence
90-103RKRRNKGAPKKKSS
Subcellular Location(s) mito 16, mito_nucl 12.666, nucl 7, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG lel:LELG_01386  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSSVIRSLPSKERLQQAKRLSFEIFDQFWNPTGKRNPAKVLRKPLRGPQVVKYYGDNNAVPTFKDFKKWFPELKLVDPREQHRQWYVADRKRRNKGAPKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.65
4 0.67
5 0.63
6 0.6
7 0.52
8 0.43
9 0.41
10 0.37
11 0.29
12 0.23
13 0.22
14 0.2
15 0.22
16 0.25
17 0.22
18 0.23
19 0.27
20 0.35
21 0.39
22 0.42
23 0.46
24 0.52
25 0.61
26 0.62
27 0.68
28 0.66
29 0.68
30 0.67
31 0.67
32 0.66
33 0.62
34 0.57
35 0.52
36 0.52
37 0.46
38 0.44
39 0.39
40 0.31
41 0.29
42 0.29
43 0.23
44 0.17
45 0.17
46 0.17
47 0.16
48 0.17
49 0.19
50 0.17
51 0.24
52 0.24
53 0.27
54 0.34
55 0.39
56 0.4
57 0.39
58 0.47
59 0.43
60 0.5
61 0.54
62 0.5
63 0.5
64 0.5
65 0.5
66 0.52
67 0.5
68 0.46
69 0.41
70 0.4
71 0.38
72 0.44
73 0.5
74 0.49
75 0.58
76 0.64
77 0.7
78 0.78
79 0.84
80 0.83
81 0.84
82 0.87
83 0.88