Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1L2V2

Protein Details
Accession A0A4Z1L2V2   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-29KILSNTTKRRSERLRRRKTTLFKKAFDHydrophilic
NLS Segment(s)
PositionSequence
11-20RRSERLRRRK
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MIKILSNTTKRRSERLRRRKTTLFKKAFDLGRDYDVDVAVIIRQHGRYYTFRSMDNLSWPPSMNEIETSYPLPKNMLPRDIQNKTFNSGRHIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.83
4 0.82
5 0.87
6 0.87
7 0.87
8 0.87
9 0.87
10 0.84
11 0.74
12 0.71
13 0.7
14 0.63
15 0.55
16 0.48
17 0.38
18 0.33
19 0.31
20 0.27
21 0.2
22 0.17
23 0.15
24 0.1
25 0.08
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.11
34 0.12
35 0.19
36 0.25
37 0.25
38 0.25
39 0.27
40 0.29
41 0.27
42 0.3
43 0.25
44 0.22
45 0.22
46 0.22
47 0.2
48 0.19
49 0.19
50 0.15
51 0.14
52 0.14
53 0.15
54 0.16
55 0.17
56 0.18
57 0.18
58 0.18
59 0.18
60 0.18
61 0.26
62 0.29
63 0.32
64 0.31
65 0.39
66 0.48
67 0.52
68 0.56
69 0.54
70 0.51
71 0.51
72 0.54
73 0.47