Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KE25

Protein Details
Accession A0A4Z1KE25    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKKNKEKKIIPPKIRIKIHPBasic
NLS Segment(s)
PositionSequence
3-15KNKEKKIIPPKIR
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto_nucl 3.833, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKKNKEKKIIPPKIRIKIHPTPTPSPPTYSAAFSHSSLLTLASSISNAKARNETAESDRDPLLDAKFRGGDEDAGYQAEDGEDGGEEYGERFVVGLGREEWRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.79
3 0.76
4 0.75
5 0.74
6 0.7
7 0.67
8 0.62
9 0.62
10 0.64
11 0.56
12 0.51
13 0.46
14 0.42
15 0.37
16 0.34
17 0.3
18 0.25
19 0.26
20 0.22
21 0.21
22 0.17
23 0.16
24 0.14
25 0.13
26 0.1
27 0.08
28 0.07
29 0.05
30 0.05
31 0.05
32 0.07
33 0.09
34 0.1
35 0.11
36 0.12
37 0.12
38 0.14
39 0.16
40 0.16
41 0.16
42 0.19
43 0.19
44 0.19
45 0.19
46 0.17
47 0.16
48 0.16
49 0.15
50 0.15
51 0.14
52 0.14
53 0.15
54 0.15
55 0.15
56 0.15
57 0.14
58 0.12
59 0.14
60 0.12
61 0.11
62 0.11
63 0.1
64 0.09
65 0.08
66 0.06
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.08
81 0.09
82 0.11
83 0.12
84 0.15