Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KVR1

Protein Details
Accession A0A4Z1KVR1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-131FGPHKHKKPYVESKGRKFEKARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
96-131KHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRINRPPVSISRIASQTNKEEKRTVVIIGTVTDDNRLLSVPKVSVAALRFTATARARILAAGGEALTLDQLALRSPTGSNTVLLRGPKNSREAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.41
4 0.42
5 0.47
6 0.49
7 0.47
8 0.46
9 0.44
10 0.45
11 0.42
12 0.35
13 0.25
14 0.22
15 0.19
16 0.17
17 0.18
18 0.14
19 0.13
20 0.12
21 0.11
22 0.1
23 0.09
24 0.09
25 0.07
26 0.08
27 0.09
28 0.09
29 0.09
30 0.1
31 0.09
32 0.12
33 0.12
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.17
40 0.15
41 0.17
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.08
48 0.07
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.1
66 0.1
67 0.11
68 0.11
69 0.13
70 0.15
71 0.16
72 0.16
73 0.18
74 0.21
75 0.23
76 0.26
77 0.28
78 0.3
79 0.34
80 0.38
81 0.41
82 0.39
83 0.37
84 0.34
85 0.37
86 0.39
87 0.39
88 0.43
89 0.47
90 0.51
91 0.55
92 0.59
93 0.59
94 0.64
95 0.69
96 0.7
97 0.71
98 0.75
99 0.79
100 0.85
101 0.83
102 0.8
103 0.73
104 0.71
105 0.71
106 0.72
107 0.73
108 0.74
109 0.8
110 0.82
111 0.88