Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E2I2

Protein Details
Accession A5E2I2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-106MKPGDKPKPPIRGPPPKRKKYBasic
NLS Segment(s)
PositionSequence
87-106KPGDKPKPPIRGPPPKRKKY
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 8.5, cyto_mito 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034099  SmD3  
Gene Ontology GO:0005829  C:cytosol  
GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0000387  P:spliceosomal snRNP assembly  
KEGG lel:LELG_03819  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01721  Sm_D3  
Amino Acid Sequences MSAGIPVRLLNEAQGHIVSIEVNNGDVYRGKLLENEDNMNSSLYDVTITNGKNGSVKHMEQVFIRGSMIRFISVPDILRNAPMFHMKPGDKPKPPIRGPPPKRKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.1
6 0.07
7 0.08
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.1
15 0.1
16 0.1
17 0.1
18 0.12
19 0.16
20 0.2
21 0.21
22 0.22
23 0.21
24 0.22
25 0.22
26 0.2
27 0.16
28 0.12
29 0.09
30 0.07
31 0.07
32 0.06
33 0.06
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.12
40 0.12
41 0.16
42 0.15
43 0.16
44 0.18
45 0.19
46 0.2
47 0.18
48 0.21
49 0.17
50 0.14
51 0.14
52 0.12
53 0.11
54 0.12
55 0.12
56 0.1
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.11
63 0.13
64 0.13
65 0.15
66 0.15
67 0.14
68 0.14
69 0.19
70 0.2
71 0.2
72 0.26
73 0.26
74 0.33
75 0.42
76 0.49
77 0.5
78 0.57
79 0.63
80 0.66
81 0.69
82 0.72
83 0.72
84 0.75
85 0.78
86 0.81