Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KCP2

Protein Details
Accession A0A4Z1KCP2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
206-248KQEAIKRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLHydrophilic
NLS Segment(s)
PositionSequence
205-239SKQEAIKRLKEERKAKKKAEKADLLELSKKRKKKH
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSASAGTPTSAPKAMSSRLLTMKFMQRAAASSPTNTSPSSIDEPSPKRQKTAQNTPTKFNVDTLADNRAIQAAIVEEEAKKQAALDRAAVEAGDTRWVLSFEGRKHLNTPTNTLRVVQTGFANLDQPSPIKAERVDDDDNNFGKEKPFMVGRRSFGKFNKVLEKQQNPGMEFTSSEEDEESEEYESEDEDSEDDPTGAKELIKASKQEAIKRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLSGSGGGSFGSGGGIKSEIKCYTCGGNHIARDCSNPKRKLQGDGGPPRKSQRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.32
4 0.35
5 0.39
6 0.41
7 0.4
8 0.41
9 0.47
10 0.44
11 0.41
12 0.37
13 0.31
14 0.32
15 0.33
16 0.34
17 0.27
18 0.25
19 0.27
20 0.27
21 0.29
22 0.27
23 0.24
24 0.19
25 0.23
26 0.26
27 0.25
28 0.25
29 0.32
30 0.36
31 0.45
32 0.53
33 0.49
34 0.48
35 0.53
36 0.6
37 0.61
38 0.68
39 0.68
40 0.69
41 0.71
42 0.72
43 0.71
44 0.65
45 0.56
46 0.46
47 0.4
48 0.31
49 0.32
50 0.29
51 0.28
52 0.25
53 0.24
54 0.23
55 0.19
56 0.17
57 0.12
58 0.1
59 0.07
60 0.06
61 0.07
62 0.08
63 0.07
64 0.08
65 0.1
66 0.09
67 0.08
68 0.08
69 0.12
70 0.16
71 0.17
72 0.18
73 0.18
74 0.18
75 0.18
76 0.17
77 0.14
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.16
88 0.16
89 0.23
90 0.24
91 0.24
92 0.26
93 0.32
94 0.35
95 0.32
96 0.36
97 0.35
98 0.37
99 0.37
100 0.35
101 0.3
102 0.25
103 0.24
104 0.19
105 0.13
106 0.11
107 0.12
108 0.11
109 0.12
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.13
121 0.18
122 0.2
123 0.18
124 0.2
125 0.23
126 0.23
127 0.22
128 0.21
129 0.16
130 0.14
131 0.14
132 0.12
133 0.1
134 0.14
135 0.15
136 0.19
137 0.22
138 0.24
139 0.29
140 0.31
141 0.33
142 0.3
143 0.35
144 0.33
145 0.32
146 0.39
147 0.36
148 0.4
149 0.45
150 0.47
151 0.42
152 0.44
153 0.44
154 0.36
155 0.34
156 0.29
157 0.21
158 0.18
159 0.17
160 0.16
161 0.13
162 0.12
163 0.11
164 0.1
165 0.1
166 0.1
167 0.09
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.05
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.06
182 0.06
183 0.07
184 0.07
185 0.06
186 0.07
187 0.1
188 0.15
189 0.16
190 0.18
191 0.18
192 0.24
193 0.27
194 0.3
195 0.35
196 0.39
197 0.42
198 0.46
199 0.54
200 0.56
201 0.62
202 0.67
203 0.71
204 0.74
205 0.79
206 0.82
207 0.82
208 0.82
209 0.82
210 0.82
211 0.79
212 0.72
213 0.72
214 0.68
215 0.62
216 0.61
217 0.55
218 0.55
219 0.54
220 0.54
221 0.51
222 0.56
223 0.63
224 0.66
225 0.74
226 0.75
227 0.79
228 0.81
229 0.82
230 0.77
231 0.68
232 0.57
233 0.46
234 0.35
235 0.24
236 0.18
237 0.11
238 0.06
239 0.05
240 0.05
241 0.05
242 0.05
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.09
250 0.11
251 0.15
252 0.17
253 0.18
254 0.2
255 0.21
256 0.26
257 0.26
258 0.28
259 0.29
260 0.32
261 0.35
262 0.37
263 0.39
264 0.34
265 0.39
266 0.42
267 0.47
268 0.51
269 0.53
270 0.55
271 0.62
272 0.64
273 0.65
274 0.67
275 0.65
276 0.66
277 0.72
278 0.75
279 0.7
280 0.7
281 0.69