Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DZR0

Protein Details
Accession A5DZR0    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-102PKDLRAKKTRALRRKLTKFERSQETDHydrophilic
NLS Segment(s)
PositionSequence
74-108KYQPKDLRAKKTRALRRKLTKFERSQETDKARKQR
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG lel:LELG_02847  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVAVKSFELRTKSKEQLENQLVELKKELANLKVQKLQRPSLPRIHIVRKNIARVLTVININQRENVKAFYAGKKYQPKDLRAKKTRALRRKLTKFERSQETDKARKQRITFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.6
4 0.62
5 0.58
6 0.52
7 0.51
8 0.43
9 0.37
10 0.34
11 0.25
12 0.21
13 0.22
14 0.23
15 0.18
16 0.26
17 0.29
18 0.32
19 0.36
20 0.38
21 0.4
22 0.43
23 0.45
24 0.43
25 0.46
26 0.47
27 0.48
28 0.49
29 0.49
30 0.49
31 0.55
32 0.53
33 0.5
34 0.54
35 0.49
36 0.49
37 0.45
38 0.4
39 0.32
40 0.28
41 0.26
42 0.2
43 0.17
44 0.14
45 0.16
46 0.17
47 0.16
48 0.18
49 0.16
50 0.16
51 0.16
52 0.16
53 0.13
54 0.14
55 0.16
56 0.18
57 0.23
58 0.24
59 0.3
60 0.38
61 0.38
62 0.45
63 0.49
64 0.51
65 0.57
66 0.65
67 0.68
68 0.68
69 0.72
70 0.7
71 0.73
72 0.77
73 0.76
74 0.75
75 0.74
76 0.77
77 0.81
78 0.85
79 0.84
80 0.84
81 0.82
82 0.82
83 0.81
84 0.77
85 0.72
86 0.71
87 0.7
88 0.69
89 0.69
90 0.7
91 0.68
92 0.68
93 0.67
94 0.68
95 0.7
96 0.73
97 0.75
98 0.73
99 0.75
100 0.74