Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E5Y3

Protein Details
Accession A5E5Y3   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-26SATSNHKPKKGTPKVKNYIIKSSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 5
Family & Domain DBs
KEGG lel:LELG_05022  -  
Amino Acid Sequences MGSATSNHKPKKGTPKVKNYIIKSSAQLQFTDLSVETPLVKFSNNSNFGMDLKDSNSGVGSGVGSGVGSGVGSGVGSGVGSGVGSGVGSAGSVLGNTNGVHNIHTIDASELINDRIYETKWKKLIGLELLFDDYGDLIGQLKEHLVINDKARFELHKEQSNIDYDEWEEYNDGSVRPANGSSKKGQSAFWKKANKLARENEKRWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.82
4 0.89
5 0.88
6 0.82
7 0.81
8 0.73
9 0.66
10 0.57
11 0.57
12 0.52
13 0.45
14 0.4
15 0.32
16 0.29
17 0.26
18 0.26
19 0.17
20 0.13
21 0.12
22 0.12
23 0.11
24 0.1
25 0.12
26 0.1
27 0.1
28 0.1
29 0.15
30 0.24
31 0.26
32 0.27
33 0.27
34 0.27
35 0.27
36 0.29
37 0.24
38 0.16
39 0.14
40 0.15
41 0.14
42 0.13
43 0.13
44 0.11
45 0.1
46 0.09
47 0.08
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.06
101 0.07
102 0.07
103 0.08
104 0.17
105 0.19
106 0.25
107 0.26
108 0.27
109 0.27
110 0.28
111 0.31
112 0.28
113 0.27
114 0.21
115 0.2
116 0.2
117 0.19
118 0.17
119 0.12
120 0.07
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.06
130 0.06
131 0.07
132 0.11
133 0.13
134 0.18
135 0.23
136 0.23
137 0.23
138 0.23
139 0.24
140 0.26
141 0.33
142 0.35
143 0.38
144 0.39
145 0.41
146 0.43
147 0.46
148 0.42
149 0.32
150 0.27
151 0.2
152 0.21
153 0.19
154 0.17
155 0.13
156 0.11
157 0.13
158 0.13
159 0.12
160 0.11
161 0.13
162 0.13
163 0.14
164 0.16
165 0.21
166 0.25
167 0.29
168 0.33
169 0.37
170 0.42
171 0.42
172 0.43
173 0.48
174 0.53
175 0.57
176 0.61
177 0.63
178 0.59
179 0.66
180 0.71
181 0.68
182 0.67
183 0.69
184 0.72
185 0.73