Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KA06

Protein Details
Accession A0A4Z1KA06    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-77AEKVEKDRKKEAKKNAQDKREPPBasic
NLS Segment(s)
PositionSequence
39-82KRKKVKDEKEAEDRKKAEKVEKDRKKEAKKNAQDKREPPLRRNQ
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSGNRSLPSGSTGSRDSTPSLKSDHGSMSSNTSQETLDKRKKVKDEKEAEDRKKAEKVEKDRKKEAKKNAQDKREPPLRRNQRMPSGGTGNATGGSGSASKEPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.24
5 0.25
6 0.23
7 0.24
8 0.23
9 0.22
10 0.23
11 0.23
12 0.22
13 0.22
14 0.21
15 0.24
16 0.24
17 0.23
18 0.21
19 0.19
20 0.17
21 0.18
22 0.23
23 0.26
24 0.31
25 0.36
26 0.4
27 0.45
28 0.53
29 0.6
30 0.63
31 0.64
32 0.64
33 0.65
34 0.72
35 0.75
36 0.7
37 0.67
38 0.6
39 0.52
40 0.48
41 0.43
42 0.4
43 0.39
44 0.46
45 0.5
46 0.58
47 0.62
48 0.67
49 0.75
50 0.78
51 0.78
52 0.79
53 0.79
54 0.8
55 0.84
56 0.83
57 0.83
58 0.81
59 0.76
60 0.74
61 0.72
62 0.66
63 0.59
64 0.62
65 0.64
66 0.65
67 0.7
68 0.69
69 0.69
70 0.69
71 0.69
72 0.63
73 0.57
74 0.5
75 0.43
76 0.36
77 0.27
78 0.23
79 0.19
80 0.13
81 0.09
82 0.09
83 0.08
84 0.09
85 0.1