Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K6L6

Protein Details
Accession A0A4Z1K6L6   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-106PIYEKPWPWQRKKEKVKPKVTPRPCPYPKHydrophilic
NLS Segment(s)
PositionSequence
88-96RKKEKVKPK
Subcellular Location(s) mito 10, cyto_nucl 5, nucl 4.5, cyto 4.5, E.R. 3, extr 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKVSNACVFALITFFNLSTAVVIPETSTTDGDLVPFNMTTPEIHPPFIVLPSSSSPTKTKRGEASKSQEVKEHEKVVPIYEKPWPWQRKKEKVKPKVTPRPCPYPKTRPCITQKEIDQGWHDKAGCYNRSWFFTYGPTHCWDAGDDCIKPDCRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.09
7 0.08
8 0.07
9 0.07
10 0.07
11 0.08
12 0.1
13 0.11
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.11
20 0.1
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.1
28 0.17
29 0.17
30 0.18
31 0.17
32 0.18
33 0.18
34 0.18
35 0.17
36 0.09
37 0.11
38 0.12
39 0.16
40 0.15
41 0.17
42 0.19
43 0.23
44 0.31
45 0.31
46 0.33
47 0.38
48 0.45
49 0.48
50 0.53
51 0.56
52 0.57
53 0.58
54 0.55
55 0.51
56 0.47
57 0.48
58 0.43
59 0.39
60 0.3
61 0.29
62 0.29
63 0.27
64 0.26
65 0.2
66 0.18
67 0.18
68 0.19
69 0.19
70 0.29
71 0.35
72 0.37
73 0.47
74 0.56
75 0.63
76 0.73
77 0.8
78 0.81
79 0.84
80 0.88
81 0.88
82 0.89
83 0.89
84 0.86
85 0.87
86 0.82
87 0.82
88 0.78
89 0.75
90 0.72
91 0.72
92 0.72
93 0.69
94 0.66
95 0.64
96 0.67
97 0.69
98 0.64
99 0.61
100 0.56
101 0.57
102 0.54
103 0.48
104 0.44
105 0.39
106 0.38
107 0.34
108 0.31
109 0.24
110 0.28
111 0.33
112 0.31
113 0.29
114 0.34
115 0.33
116 0.37
117 0.4
118 0.37
119 0.31
120 0.34
121 0.38
122 0.34
123 0.34
124 0.33
125 0.32
126 0.31
127 0.3
128 0.26
129 0.23
130 0.26
131 0.28
132 0.25
133 0.24
134 0.3