Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1KF40

Protein Details
Accession A0A4Z1KF40    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-82RGERREKLNQEEKKEKKKKKKVHBasic
NLS Segment(s)
PositionSequence
54-82KEKREERGERREKLNQEEKKEKKKKKKVH
Subcellular Location(s) cyto 14, mito 8.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
Amino Acid Sequences MEGEEGWNIIRVVLRRVPGGPAYGYSFRIKEEEEVVKSNFVRKSGEGEGLLGIKEKREERGERREKLNQEEKKEKKKKKKVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.24
5 0.22
6 0.23
7 0.19
8 0.17
9 0.2
10 0.2
11 0.22
12 0.21
13 0.2
14 0.19
15 0.2
16 0.19
17 0.15
18 0.18
19 0.19
20 0.19
21 0.22
22 0.22
23 0.22
24 0.22
25 0.25
26 0.22
27 0.19
28 0.18
29 0.16
30 0.2
31 0.2
32 0.22
33 0.17
34 0.16
35 0.16
36 0.14
37 0.14
38 0.11
39 0.09
40 0.08
41 0.11
42 0.12
43 0.15
44 0.21
45 0.29
46 0.34
47 0.46
48 0.54
49 0.56
50 0.62
51 0.66
52 0.65
53 0.67
54 0.7
55 0.66
56 0.66
57 0.71
58 0.74
59 0.77
60 0.83
61 0.84
62 0.86