Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1JSU6

Protein Details
Accession A0A4Z1JSU6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-96FATSTLRRPKRAQKRIKNSLPTLNTHydrophilic
NLS Segment(s)
PositionSequence
79-86RPKRAQKR
Subcellular Location(s) cyto 10, mito 9, pero 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MCTTPQIIDEIAAGIRPKAYAATVMLSFLKALLLKMSNVAVNGVALVTGGAAGIGEETGFAFAEANTSGIIFATSTLRRPKRAQKRIKNSLPTLNTEPWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.09
9 0.12
10 0.11
11 0.13
12 0.12
13 0.12
14 0.11
15 0.09
16 0.09
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.09
23 0.1
24 0.09
25 0.09
26 0.09
27 0.07
28 0.06
29 0.06
30 0.05
31 0.04
32 0.03
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.05
58 0.04
59 0.05
60 0.08
61 0.09
62 0.14
63 0.23
64 0.27
65 0.32
66 0.39
67 0.49
68 0.57
69 0.67
70 0.74
71 0.75
72 0.83
73 0.89
74 0.92
75 0.9
76 0.85
77 0.84
78 0.77
79 0.72
80 0.68