Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1K155

Protein Details
Accession A0A4Z1K155    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-40RSIKESIERSRKQKNKNKKVNKQTISAPHydrophilic
NLS Segment(s)
PositionSequence
21-31RSRKQKNKNKK
Subcellular Location(s) mito 18, nucl 5, cyto_nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGALSAVLAIPYRSIKESIERSRKQKNKNKKVNKQTISAPGSRTPSVYRETGGRTQRTERLEGRVSPEKGRSQSLGYLPSFETPRAELEADLGEGVNKGKGKGKEIEGASLQKLSTVLRTTSQRDFALDATQQVEVIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.23
4 0.32
5 0.41
6 0.5
7 0.55
8 0.59
9 0.69
10 0.76
11 0.79
12 0.8
13 0.81
14 0.81
15 0.86
16 0.91
17 0.9
18 0.93
19 0.94
20 0.88
21 0.8
22 0.75
23 0.73
24 0.67
25 0.59
26 0.5
27 0.43
28 0.43
29 0.39
30 0.35
31 0.27
32 0.25
33 0.25
34 0.23
35 0.2
36 0.18
37 0.22
38 0.28
39 0.32
40 0.31
41 0.31
42 0.34
43 0.39
44 0.38
45 0.39
46 0.33
47 0.33
48 0.33
49 0.31
50 0.34
51 0.36
52 0.35
53 0.33
54 0.34
55 0.32
56 0.31
57 0.31
58 0.27
59 0.2
60 0.22
61 0.22
62 0.22
63 0.19
64 0.19
65 0.18
66 0.19
67 0.18
68 0.15
69 0.14
70 0.11
71 0.12
72 0.12
73 0.13
74 0.1
75 0.1
76 0.11
77 0.1
78 0.09
79 0.07
80 0.06
81 0.06
82 0.06
83 0.07
84 0.08
85 0.09
86 0.15
87 0.17
88 0.21
89 0.25
90 0.28
91 0.33
92 0.33
93 0.36
94 0.33
95 0.33
96 0.3
97 0.27
98 0.23
99 0.17
100 0.17
101 0.14
102 0.15
103 0.15
104 0.16
105 0.2
106 0.25
107 0.29
108 0.33
109 0.38
110 0.34
111 0.33
112 0.34
113 0.3
114 0.3
115 0.27
116 0.23
117 0.2
118 0.2