Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JSN5

Protein Details
Accession A0A4Z1JSN5   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGEEKRRKNPKPKPKIEQEKPGNRWNTBasic
NLS Segment(s)
PositionSequence
5-17KRRKNPKPKPKIE
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MGEEKRRKNPKPKPKIEQEKPGNRWNTQCDDGWEAVKSRRGEFKNEVKAGRQSQRIMRYRGSVPVSQYGGAYIDDYDYDYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.9
4 0.9
5 0.89
6 0.88
7 0.83
8 0.81
9 0.74
10 0.65
11 0.62
12 0.56
13 0.51
14 0.43
15 0.39
16 0.34
17 0.33
18 0.31
19 0.27
20 0.23
21 0.19
22 0.18
23 0.23
24 0.21
25 0.19
26 0.26
27 0.26
28 0.31
29 0.36
30 0.42
31 0.46
32 0.48
33 0.47
34 0.42
35 0.46
36 0.47
37 0.46
38 0.42
39 0.37
40 0.4
41 0.49
42 0.52
43 0.5
44 0.47
45 0.46
46 0.43
47 0.46
48 0.44
49 0.37
50 0.34
51 0.36
52 0.35
53 0.31
54 0.29
55 0.23
56 0.2
57 0.17
58 0.15
59 0.09
60 0.08
61 0.08