Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1JM16

Protein Details
Accession A0A4Z1JM16    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
182-206SSSGEKKRKIGKKMRILMRERRRTIBasic
217-251KESKEEADKERRARKNREKKVKRKAKEKALKAAAGBasic
NLS Segment(s)
PositionSequence
184-206SGEKKRKIGKKMRILMRERRRTI
215-249REKESKEEADKERRARKNREKKVKRKAKEKALKAA
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPDAKRVRRSDLYTRSSSSSPEPPSPIDPDVSARFNNQLASLYGPISFQSCGTENTLNIEPINDAPHSPPLDDDQDQAEEFDFRLFSNVKEGKIVLKEEAVDKGIFVRERDKSYYFTGPIEGQRKEEYAIAAISGEDVLEGREKRYWGLEVPWRVRVVKIGVGGQKKLGSNGLFGARNSSSGEKKRKIGKKMRILMRERRRTIEAQEQAMTREKESKEEADKERRARKNREKKVKRKAKEKALKAAAGGNKQTEPGVDGADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.63
4 0.64
5 0.6
6 0.53
7 0.49
8 0.43
9 0.41
10 0.4
11 0.4
12 0.39
13 0.38
14 0.41
15 0.43
16 0.39
17 0.33
18 0.29
19 0.29
20 0.3
21 0.31
22 0.28
23 0.25
24 0.26
25 0.25
26 0.25
27 0.2
28 0.18
29 0.16
30 0.18
31 0.17
32 0.15
33 0.14
34 0.13
35 0.13
36 0.13
37 0.12
38 0.09
39 0.11
40 0.12
41 0.13
42 0.17
43 0.19
44 0.17
45 0.21
46 0.23
47 0.2
48 0.19
49 0.18
50 0.14
51 0.13
52 0.16
53 0.11
54 0.1
55 0.11
56 0.17
57 0.17
58 0.16
59 0.16
60 0.17
61 0.22
62 0.22
63 0.21
64 0.18
65 0.19
66 0.19
67 0.18
68 0.15
69 0.1
70 0.1
71 0.1
72 0.08
73 0.06
74 0.09
75 0.09
76 0.09
77 0.18
78 0.2
79 0.19
80 0.2
81 0.21
82 0.21
83 0.23
84 0.24
85 0.15
86 0.14
87 0.14
88 0.14
89 0.15
90 0.14
91 0.11
92 0.1
93 0.1
94 0.12
95 0.12
96 0.12
97 0.15
98 0.17
99 0.2
100 0.24
101 0.25
102 0.25
103 0.28
104 0.3
105 0.26
106 0.24
107 0.22
108 0.2
109 0.24
110 0.26
111 0.23
112 0.21
113 0.21
114 0.21
115 0.2
116 0.19
117 0.14
118 0.1
119 0.09
120 0.08
121 0.07
122 0.06
123 0.05
124 0.04
125 0.03
126 0.02
127 0.02
128 0.03
129 0.06
130 0.06
131 0.07
132 0.09
133 0.1
134 0.11
135 0.12
136 0.13
137 0.11
138 0.15
139 0.2
140 0.25
141 0.27
142 0.3
143 0.29
144 0.29
145 0.28
146 0.26
147 0.22
148 0.18
149 0.17
150 0.18
151 0.22
152 0.24
153 0.24
154 0.23
155 0.24
156 0.21
157 0.21
158 0.2
159 0.15
160 0.14
161 0.16
162 0.19
163 0.17
164 0.17
165 0.2
166 0.17
167 0.17
168 0.19
169 0.2
170 0.22
171 0.29
172 0.39
173 0.39
174 0.45
175 0.54
176 0.6
177 0.66
178 0.7
179 0.72
180 0.74
181 0.79
182 0.82
183 0.81
184 0.8
185 0.81
186 0.82
187 0.82
188 0.74
189 0.7
190 0.65
191 0.59
192 0.58
193 0.57
194 0.52
195 0.45
196 0.44
197 0.4
198 0.38
199 0.42
200 0.37
201 0.29
202 0.31
203 0.28
204 0.29
205 0.32
206 0.36
207 0.36
208 0.43
209 0.49
210 0.52
211 0.59
212 0.63
213 0.7
214 0.73
215 0.75
216 0.78
217 0.82
218 0.83
219 0.87
220 0.9
221 0.91
222 0.93
223 0.95
224 0.95
225 0.93
226 0.93
227 0.92
228 0.92
229 0.91
230 0.88
231 0.88
232 0.84
233 0.76
234 0.67
235 0.64
236 0.58
237 0.54
238 0.49
239 0.41
240 0.34
241 0.33
242 0.32
243 0.26
244 0.22
245 0.17