Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JYL4

Protein Details
Accession A0A4Z1JYL4   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-68EWTVAKMKRRNEEERKKKEKEKKKKEKEKEKKKKKKEEKEKEKKKKKKKKGRKRNQESTPKBasic
NLS Segment(s)
PositionSequence
13-64KMKRRNEEERKKKEKEKKKKEKEKEKKKKKKEEKEKEKKKKKKKKGRKRNQE
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MGGWQEQEWTVAKMKRRNEEERKKKEKEKKKKEKEKEKKKKKKEEKEKEKKKKKKKKGRKRNQESTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.54
4 0.62
5 0.67
6 0.75
7 0.79
8 0.83
9 0.86
10 0.83
11 0.86
12 0.86
13 0.86
14 0.86
15 0.86
16 0.87
17 0.89
18 0.93
19 0.94
20 0.95
21 0.95
22 0.95
23 0.95
24 0.95
25 0.95
26 0.95
27 0.95
28 0.95
29 0.95
30 0.95
31 0.95
32 0.95
33 0.96
34 0.97
35 0.97
36 0.97
37 0.96
38 0.96
39 0.96
40 0.95
41 0.96
42 0.96
43 0.96
44 0.96
45 0.97
46 0.97
47 0.97
48 0.96