Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K5L8

Protein Details
Accession A0A4Z1K5L8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
144-200WVYMMKAKSSQRKRRKGKGKEKEIVKETVKVKVKVNKRKHRKHKKHRRTEVETAGGSBasic
NLS Segment(s)
PositionSequence
150-191AKSSQRKRRKGKGKEKEIVKETVKVKVKVNKRKHRKHKKHRR
Subcellular Location(s) mito 11.5, extr 8, cyto_mito 7.5, E.R. 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPIAFSILSPRSFPNKVANSTSPIINLVTQSSAAFSAYTPSPTAFPASSTLPLESPIPTALPDVLREKFSTIIVDAPTTTYTSYIELNDNAFASEPASLPDSTPIGDSYTVETQAPQPNNSGRDIGIVIGCIIGVLILGLIGWVYMMKAKSSQRKRRKGKGKEKEIVKETVKVKVKVNKRKHRKHKKHRRTEVETAGGSGGEAPAAGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.4
4 0.44
5 0.49
6 0.48
7 0.46
8 0.47
9 0.45
10 0.36
11 0.3
12 0.26
13 0.21
14 0.18
15 0.14
16 0.13
17 0.12
18 0.11
19 0.11
20 0.1
21 0.09
22 0.09
23 0.07
24 0.1
25 0.1
26 0.12
27 0.12
28 0.12
29 0.13
30 0.13
31 0.16
32 0.13
33 0.13
34 0.14
35 0.16
36 0.18
37 0.18
38 0.18
39 0.15
40 0.16
41 0.16
42 0.14
43 0.13
44 0.11
45 0.1
46 0.09
47 0.1
48 0.1
49 0.1
50 0.11
51 0.14
52 0.15
53 0.16
54 0.16
55 0.17
56 0.16
57 0.16
58 0.15
59 0.11
60 0.13
61 0.12
62 0.12
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.07
69 0.07
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.09
97 0.1
98 0.1
99 0.09
100 0.09
101 0.12
102 0.18
103 0.18
104 0.16
105 0.18
106 0.2
107 0.22
108 0.23
109 0.2
110 0.14
111 0.15
112 0.14
113 0.12
114 0.09
115 0.08
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.02
122 0.02
123 0.02
124 0.01
125 0.01
126 0.01
127 0.01
128 0.01
129 0.01
130 0.02
131 0.02
132 0.02
133 0.05
134 0.05
135 0.06
136 0.11
137 0.17
138 0.28
139 0.39
140 0.5
141 0.58
142 0.69
143 0.78
144 0.85
145 0.9
146 0.91
147 0.91
148 0.92
149 0.92
150 0.89
151 0.87
152 0.85
153 0.78
154 0.74
155 0.65
156 0.61
157 0.52
158 0.53
159 0.52
160 0.46
161 0.49
162 0.5
163 0.58
164 0.62
165 0.71
166 0.73
167 0.77
168 0.86
169 0.9
170 0.94
171 0.95
172 0.96
173 0.97
174 0.97
175 0.97
176 0.97
177 0.96
178 0.94
179 0.92
180 0.9
181 0.85
182 0.74
183 0.64
184 0.53
185 0.42
186 0.33
187 0.23
188 0.14
189 0.07
190 0.06