Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E564

Protein Details
Accession A5E564    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-33AAVPHPKIVKKYTKKFKRHHSDRYDRVKENBasic
NLS Segment(s)
PositionSequence
13-23KKYTKKFKRHH
Subcellular Location(s) mito 13, cyto 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lel:LELG_04753  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences LVAAAVPHPKIVKKYTKKFKRHHSDRYDRVKENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNKKTKYLTPSGHKVFVVKNLKDLDVLVMHTRTYAAEIAHNISAKNRIEIVKKANKIGVKVTNPKGRVSIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.75
4 0.82
5 0.87
6 0.9
7 0.91
8 0.9
9 0.9
10 0.9
11 0.9
12 0.9
13 0.91
14 0.88
15 0.8
16 0.76
17 0.76
18 0.75
19 0.75
20 0.75
21 0.71
22 0.65
23 0.64
24 0.68
25 0.63
26 0.61
27 0.58
28 0.57
29 0.6
30 0.67
31 0.69
32 0.61
33 0.58
34 0.55
35 0.51
36 0.53
37 0.53
38 0.54
39 0.55
40 0.59
41 0.56
42 0.52
43 0.48
44 0.38
45 0.32
46 0.25
47 0.26
48 0.27
49 0.27
50 0.28
51 0.28
52 0.29
53 0.32
54 0.37
55 0.36
56 0.35
57 0.43
58 0.44
59 0.45
60 0.42
61 0.38
62 0.31
63 0.34
64 0.36
65 0.28
66 0.31
67 0.3
68 0.3
69 0.29
70 0.28
71 0.2
72 0.13
73 0.14
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.08
80 0.09
81 0.09
82 0.08
83 0.09
84 0.11
85 0.13
86 0.15
87 0.16
88 0.14
89 0.15
90 0.21
91 0.19
92 0.2
93 0.21
94 0.22
95 0.26
96 0.31
97 0.39
98 0.42
99 0.44
100 0.45
101 0.47
102 0.46
103 0.45
104 0.47
105 0.46
106 0.45
107 0.52
108 0.57
109 0.61
110 0.6
111 0.59
112 0.56