Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1K6H7

Protein Details
Accession A0A4Z1K6H7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-97PPKTPSPTKKTSPKKKVGPKNAPIKAHydrophilic
NLS Segment(s)
PositionSequence
76-110PSPTKKTSPKKKVGPKNAPIKAAPKSRGKKGTVKK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MTTLTLSAKETEMLVAVMSEMGEIPSNINFDRVAARVKVKFAKNARQSFKKLFEKLKDQAGPSPDDEDGATPPKTPSPTKKTSPKKKVGPKNAPIKAAPKSRGKKGTVKKEVKEEEVDSGDELAEPVLDDEDGKSPENIPSLKAKSLGKNSVVCSSTGSSESLQISDEVAKMSVVEAEETFSTSIEESPVDEQVDLDEQLLAAQSNMSVGAYRHWKALNDYTFLQNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.06
5 0.05
6 0.05
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.08
13 0.1
14 0.1
15 0.11
16 0.11
17 0.11
18 0.14
19 0.14
20 0.17
21 0.18
22 0.23
23 0.24
24 0.3
25 0.37
26 0.37
27 0.44
28 0.47
29 0.55
30 0.59
31 0.66
32 0.69
33 0.69
34 0.73
35 0.71
36 0.74
37 0.72
38 0.69
39 0.68
40 0.66
41 0.66
42 0.63
43 0.64
44 0.58
45 0.51
46 0.49
47 0.44
48 0.4
49 0.33
50 0.32
51 0.23
52 0.2
53 0.19
54 0.15
55 0.14
56 0.15
57 0.14
58 0.13
59 0.13
60 0.16
61 0.19
62 0.22
63 0.29
64 0.34
65 0.41
66 0.47
67 0.57
68 0.65
69 0.73
70 0.79
71 0.79
72 0.8
73 0.84
74 0.87
75 0.87
76 0.87
77 0.84
78 0.84
79 0.79
80 0.72
81 0.63
82 0.57
83 0.53
84 0.49
85 0.46
86 0.45
87 0.45
88 0.49
89 0.55
90 0.54
91 0.57
92 0.59
93 0.66
94 0.67
95 0.69
96 0.64
97 0.65
98 0.64
99 0.57
100 0.51
101 0.4
102 0.32
103 0.26
104 0.24
105 0.16
106 0.13
107 0.11
108 0.08
109 0.07
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.06
119 0.08
120 0.08
121 0.09
122 0.09
123 0.11
124 0.13
125 0.13
126 0.12
127 0.18
128 0.2
129 0.2
130 0.23
131 0.25
132 0.28
133 0.34
134 0.37
135 0.34
136 0.35
137 0.36
138 0.38
139 0.36
140 0.3
141 0.26
142 0.23
143 0.21
144 0.18
145 0.18
146 0.13
147 0.15
148 0.15
149 0.13
150 0.12
151 0.11
152 0.11
153 0.11
154 0.11
155 0.08
156 0.08
157 0.08
158 0.07
159 0.07
160 0.08
161 0.07
162 0.07
163 0.07
164 0.08
165 0.08
166 0.1
167 0.1
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.1
176 0.11
177 0.12
178 0.11
179 0.11
180 0.11
181 0.13
182 0.12
183 0.11
184 0.09
185 0.08
186 0.08
187 0.09
188 0.07
189 0.05
190 0.05
191 0.04
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.12
198 0.19
199 0.2
200 0.24
201 0.26
202 0.28
203 0.33
204 0.42
205 0.41
206 0.39
207 0.41