Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1KA42

Protein Details
Accession A0A4Z1KA42    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81QESSNRRQGFAKKKEKPKDLHydrophilic
NLS Segment(s)
PositionSequence
72-79AKKKEKPK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MAASPIMIVTPRNLVGATVKLATQIIQPVNTSPKSLADVVPLSVSKPSRGKCPNEIQIPGHQESSNRRQGFAKKKEKPKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.15
5 0.13
6 0.12
7 0.12
8 0.12
9 0.12
10 0.11
11 0.13
12 0.12
13 0.13
14 0.13
15 0.14
16 0.19
17 0.19
18 0.19
19 0.15
20 0.15
21 0.16
22 0.17
23 0.15
24 0.13
25 0.13
26 0.12
27 0.13
28 0.11
29 0.09
30 0.11
31 0.11
32 0.12
33 0.17
34 0.17
35 0.26
36 0.32
37 0.36
38 0.41
39 0.49
40 0.54
41 0.54
42 0.56
43 0.49
44 0.5
45 0.51
46 0.45
47 0.39
48 0.31
49 0.3
50 0.34
51 0.4
52 0.43
53 0.38
54 0.38
55 0.41
56 0.5
57 0.58
58 0.61
59 0.64
60 0.65
61 0.75