Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DUM7

Protein Details
Accession A5DUM7   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-132AAKMHAKKVERMKKREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
39-40KK
51-59AKRNSFKER
79-132EKESARKQKIADLKRRREIKAEKERYERMAAKMHAKKVERMKKREKRNKLLKER
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG lel:LELG_01063  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTTSNLRYDEIPKKYIDPLAPKDKSEGLRVNGKDWKIKKDAFRVKTLGVAKRNSFKERELKKLQEQQYKERLKELQEEKESARKQKIADLKRRREIKAEKERYERMAAKMHAKKVERMKKREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.42
4 0.4
5 0.39
6 0.42
7 0.5
8 0.5
9 0.48
10 0.48
11 0.49
12 0.45
13 0.44
14 0.42
15 0.35
16 0.42
17 0.42
18 0.43
19 0.43
20 0.42
21 0.43
22 0.4
23 0.43
24 0.4
25 0.44
26 0.46
27 0.52
28 0.59
29 0.55
30 0.57
31 0.54
32 0.48
33 0.5
34 0.49
35 0.44
36 0.4
37 0.39
38 0.37
39 0.41
40 0.45
41 0.42
42 0.39
43 0.37
44 0.41
45 0.42
46 0.48
47 0.47
48 0.47
49 0.51
50 0.58
51 0.61
52 0.59
53 0.57
54 0.56
55 0.59
56 0.59
57 0.52
58 0.47
59 0.41
60 0.36
61 0.42
62 0.39
63 0.37
64 0.35
65 0.37
66 0.35
67 0.42
68 0.42
69 0.39
70 0.38
71 0.33
72 0.31
73 0.36
74 0.43
75 0.44
76 0.52
77 0.58
78 0.63
79 0.69
80 0.75
81 0.7
82 0.7
83 0.7
84 0.7
85 0.7
86 0.71
87 0.69
88 0.7
89 0.72
90 0.66
91 0.65
92 0.58
93 0.5
94 0.49
95 0.45
96 0.48
97 0.51
98 0.53
99 0.53
100 0.52
101 0.56
102 0.59
103 0.66
104 0.66
105 0.69
106 0.75
107 0.76
108 0.86
109 0.89
110 0.89
111 0.9
112 0.91