Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1JVP4

Protein Details
Accession A0A4Z1JVP4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-74EIHETNTWRRKVKRKGPKGPIBasic
NLS Segment(s)
PositionSequence
62-74RRKVKRKGPKGPI
Subcellular Location(s) nucl 13, mito 11.5, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences MYEIPRVIVATRRRRNDSDCQSRHKGAAPLGAVCDVEIRKTFPFSSPDNPNKDEIHETNTWRRKVKRKGPKGPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.69
4 0.7
5 0.7
6 0.67
7 0.68
8 0.68
9 0.65
10 0.61
11 0.54
12 0.47
13 0.37
14 0.36
15 0.29
16 0.23
17 0.22
18 0.21
19 0.16
20 0.12
21 0.13
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.11
28 0.12
29 0.12
30 0.16
31 0.19
32 0.25
33 0.32
34 0.39
35 0.42
36 0.43
37 0.44
38 0.41
39 0.41
40 0.41
41 0.33
42 0.32
43 0.31
44 0.34
45 0.41
46 0.48
47 0.5
48 0.52
49 0.58
50 0.63
51 0.7
52 0.76
53 0.77
54 0.81