Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1JIC3

Protein Details
Accession A0A4Z1JIC3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-85RSGCSYKLPKGRKYKKRFGVNAWLVHydrophilic
NLS Segment(s)
PositionSequence
71-76GRKYKK
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MCQRWLSGAQRAILQQENRVVLSVPPSRQISWLLRDTNTKREPKSVLNGIYPAIDKACRLRSGCSYKLPKGRKYKKRFGVNAWLVLIRKFGSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.29
4 0.29
5 0.26
6 0.26
7 0.23
8 0.17
9 0.23
10 0.24
11 0.2
12 0.23
13 0.25
14 0.25
15 0.26
16 0.3
17 0.27
18 0.28
19 0.32
20 0.29
21 0.28
22 0.35
23 0.37
24 0.41
25 0.44
26 0.44
27 0.4
28 0.42
29 0.44
30 0.39
31 0.42
32 0.38
33 0.33
34 0.29
35 0.29
36 0.25
37 0.23
38 0.2
39 0.14
40 0.1
41 0.08
42 0.08
43 0.11
44 0.14
45 0.17
46 0.18
47 0.21
48 0.28
49 0.36
50 0.39
51 0.44
52 0.47
53 0.5
54 0.58
55 0.62
56 0.62
57 0.67
58 0.74
59 0.76
60 0.79
61 0.83
62 0.84
63 0.88
64 0.85
65 0.82
66 0.82
67 0.77
68 0.72
69 0.64
70 0.57
71 0.47
72 0.41
73 0.36