Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K510

Protein Details
Accession A0A4Z1K510    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKTKTTVKKYKTRAAKRRAECRANNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11, mito 7.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MAKTKTTVKKYKTRAAKRRAECRANNLPLPPPRTVFLAPRAMVWLTAKEKRVYTKTYKWTMAMQSFKAGRYWPKVLEQYAQFPLAHLDRKLYKNYGSIRDKLSVSRDQLDDMEGEQDDRRAAMLARRAANKANRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.86
4 0.86
5 0.88
6 0.88
7 0.87
8 0.8
9 0.79
10 0.79
11 0.74
12 0.68
13 0.6
14 0.57
15 0.53
16 0.53
17 0.46
18 0.37
19 0.33
20 0.34
21 0.33
22 0.3
23 0.29
24 0.32
25 0.3
26 0.29
27 0.29
28 0.25
29 0.24
30 0.21
31 0.2
32 0.18
33 0.22
34 0.24
35 0.24
36 0.26
37 0.3
38 0.33
39 0.34
40 0.37
41 0.41
42 0.47
43 0.5
44 0.5
45 0.46
46 0.45
47 0.44
48 0.43
49 0.37
50 0.29
51 0.28
52 0.27
53 0.26
54 0.23
55 0.2
56 0.18
57 0.2
58 0.22
59 0.19
60 0.23
61 0.25
62 0.25
63 0.28
64 0.26
65 0.25
66 0.25
67 0.25
68 0.2
69 0.18
70 0.19
71 0.17
72 0.18
73 0.14
74 0.16
75 0.2
76 0.23
77 0.27
78 0.27
79 0.26
80 0.3
81 0.35
82 0.42
83 0.41
84 0.41
85 0.41
86 0.42
87 0.41
88 0.38
89 0.38
90 0.34
91 0.33
92 0.34
93 0.31
94 0.29
95 0.29
96 0.27
97 0.22
98 0.17
99 0.16
100 0.11
101 0.12
102 0.11
103 0.12
104 0.11
105 0.1
106 0.1
107 0.09
108 0.1
109 0.14
110 0.21
111 0.27
112 0.32
113 0.36
114 0.38
115 0.44