Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JK57

Protein Details
Accession A0A4Z1JK57   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-43TSVYICSRFKRWQRNHKKIVSHRRCGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MCVEQEVRCTGCNESSTSVYICSRFKRWQRNHKKIVSHRRCGEFSISRPRKQTSLAHVDCPIQSEQEQEQIEYEHSEAFMYDYASQCPSPIPTYPAYAMPYPHYPSWCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.23
5 0.23
6 0.21
7 0.22
8 0.23
9 0.24
10 0.27
11 0.34
12 0.42
13 0.51
14 0.6
15 0.68
16 0.76
17 0.83
18 0.87
19 0.85
20 0.87
21 0.86
22 0.87
23 0.85
24 0.83
25 0.78
26 0.74
27 0.68
28 0.6
29 0.56
30 0.49
31 0.44
32 0.47
33 0.46
34 0.44
35 0.46
36 0.45
37 0.4
38 0.39
39 0.39
40 0.35
41 0.39
42 0.37
43 0.36
44 0.36
45 0.35
46 0.31
47 0.29
48 0.22
49 0.13
50 0.12
51 0.13
52 0.12
53 0.17
54 0.18
55 0.15
56 0.15
57 0.15
58 0.16
59 0.14
60 0.13
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.09
69 0.09
70 0.11
71 0.13
72 0.13
73 0.12
74 0.13
75 0.14
76 0.15
77 0.16
78 0.19
79 0.18
80 0.23
81 0.24
82 0.26
83 0.27
84 0.26
85 0.26
86 0.27
87 0.31
88 0.32
89 0.33