Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JAI8

Protein Details
Accession A0A4Z1JAI8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
156-179SPVAKEKKAAPKKLRKKASRVLNPHydrophilic
NLS Segment(s)
PositionSequence
157-177PVAKEKKAAPKKLRKKASRVL
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MAANASAHSNLVTLHTNLHTLLIKLSLSLHLTSPSPLPQLATTPSNRFSTQRFPPLNDQYNHNHTYKNNPLDPLEVLYTLSPPSFHYLPRSTLLPPQILRKGFIETPENNPPLLEGTRMQIMVIPRGVRKIVVHFLVYDPVLKETKEHPKISPLASPVAKEKKAAPKKLRKKASRVLNPQEKIRDFPTKRRSTSRFAYAEMDANGNAGGSLSVNQNHNFDGMEIEVMGKGHVSEMNVEREEDREGEYVVMRRVVKLPRRVWCGRNEDLRLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.2
6 0.18
7 0.16
8 0.16
9 0.15
10 0.14
11 0.13
12 0.14
13 0.13
14 0.14
15 0.15
16 0.15
17 0.15
18 0.16
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.17
25 0.16
26 0.18
27 0.21
28 0.24
29 0.25
30 0.28
31 0.31
32 0.33
33 0.33
34 0.33
35 0.33
36 0.37
37 0.4
38 0.46
39 0.45
40 0.47
41 0.54
42 0.61
43 0.65
44 0.58
45 0.56
46 0.52
47 0.56
48 0.55
49 0.47
50 0.41
51 0.34
52 0.42
53 0.46
54 0.46
55 0.42
56 0.4
57 0.4
58 0.39
59 0.39
60 0.32
61 0.24
62 0.17
63 0.15
64 0.13
65 0.12
66 0.11
67 0.1
68 0.08
69 0.08
70 0.12
71 0.13
72 0.14
73 0.19
74 0.21
75 0.24
76 0.25
77 0.26
78 0.23
79 0.26
80 0.28
81 0.26
82 0.24
83 0.27
84 0.31
85 0.3
86 0.3
87 0.27
88 0.28
89 0.25
90 0.27
91 0.26
92 0.23
93 0.28
94 0.33
95 0.33
96 0.29
97 0.28
98 0.25
99 0.22
100 0.2
101 0.16
102 0.09
103 0.1
104 0.11
105 0.11
106 0.11
107 0.11
108 0.11
109 0.11
110 0.12
111 0.12
112 0.11
113 0.12
114 0.12
115 0.11
116 0.11
117 0.13
118 0.14
119 0.14
120 0.14
121 0.13
122 0.14
123 0.14
124 0.14
125 0.11
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.14
132 0.24
133 0.29
134 0.31
135 0.3
136 0.34
137 0.37
138 0.37
139 0.35
140 0.26
141 0.25
142 0.24
143 0.24
144 0.26
145 0.29
146 0.28
147 0.26
148 0.3
149 0.36
150 0.43
151 0.52
152 0.55
153 0.6
154 0.7
155 0.79
156 0.84
157 0.8
158 0.8
159 0.79
160 0.8
161 0.8
162 0.78
163 0.79
164 0.78
165 0.74
166 0.7
167 0.69
168 0.59
169 0.52
170 0.47
171 0.48
172 0.41
173 0.49
174 0.55
175 0.56
176 0.59
177 0.65
178 0.66
179 0.62
180 0.65
181 0.64
182 0.56
183 0.5
184 0.49
185 0.41
186 0.39
187 0.33
188 0.28
189 0.18
190 0.16
191 0.14
192 0.1
193 0.08
194 0.05
195 0.04
196 0.04
197 0.05
198 0.07
199 0.1
200 0.13
201 0.15
202 0.16
203 0.16
204 0.16
205 0.15
206 0.13
207 0.12
208 0.1
209 0.09
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.05
217 0.06
218 0.07
219 0.08
220 0.12
221 0.16
222 0.21
223 0.22
224 0.23
225 0.22
226 0.23
227 0.24
228 0.2
229 0.2
230 0.15
231 0.15
232 0.16
233 0.18
234 0.2
235 0.2
236 0.24
237 0.21
238 0.22
239 0.27
240 0.35
241 0.41
242 0.47
243 0.53
244 0.57
245 0.65
246 0.7
247 0.69
248 0.69
249 0.69
250 0.67
251 0.69
252 0.64