Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1K327

Protein Details
Accession A0A4Z1K327    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-175GYSTPTKTSRKIPKRTRMSAKAQLKSHydrophilic
NLS Segment(s)
PositionSequence
104-109SGIKRK
158-167SRKIPKRTRM
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MNITPNSIFSGRCQISIFQYRCLHNGQENSARCRSHFDNKPCIPDVVYSEEVKDRDCAECVMRNSGYTSDEIYMNTPPNTATKSSELDDTRVLKRPGLFNRSRSGIKRKSTPSGTGGDKLARSKDIKFHQARNDELRYRRAIVKSRSEGGYSTPTKTSRKIPKRTRMSAKAQLKSKAEAEMTDEMEFDMEMEGYGDKNDVTDLSHKLSSLTCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.42
4 0.41
5 0.39
6 0.43
7 0.44
8 0.45
9 0.46
10 0.42
11 0.38
12 0.4
13 0.39
14 0.42
15 0.45
16 0.48
17 0.5
18 0.47
19 0.42
20 0.44
21 0.44
22 0.45
23 0.51
24 0.52
25 0.57
26 0.6
27 0.66
28 0.61
29 0.56
30 0.47
31 0.39
32 0.35
33 0.31
34 0.3
35 0.24
36 0.24
37 0.26
38 0.25
39 0.24
40 0.22
41 0.17
42 0.16
43 0.16
44 0.16
45 0.16
46 0.21
47 0.22
48 0.25
49 0.24
50 0.23
51 0.23
52 0.23
53 0.21
54 0.16
55 0.16
56 0.12
57 0.13
58 0.12
59 0.12
60 0.13
61 0.14
62 0.13
63 0.12
64 0.11
65 0.12
66 0.14
67 0.14
68 0.15
69 0.16
70 0.18
71 0.18
72 0.23
73 0.22
74 0.22
75 0.24
76 0.24
77 0.24
78 0.28
79 0.28
80 0.24
81 0.25
82 0.3
83 0.33
84 0.38
85 0.39
86 0.35
87 0.38
88 0.4
89 0.41
90 0.38
91 0.42
92 0.41
93 0.41
94 0.45
95 0.46
96 0.48
97 0.48
98 0.47
99 0.41
100 0.38
101 0.36
102 0.3
103 0.28
104 0.23
105 0.22
106 0.2
107 0.19
108 0.17
109 0.17
110 0.17
111 0.23
112 0.26
113 0.34
114 0.37
115 0.42
116 0.46
117 0.49
118 0.51
119 0.5
120 0.52
121 0.48
122 0.47
123 0.45
124 0.4
125 0.39
126 0.41
127 0.39
128 0.42
129 0.42
130 0.48
131 0.48
132 0.49
133 0.47
134 0.43
135 0.38
136 0.33
137 0.36
138 0.28
139 0.27
140 0.27
141 0.29
142 0.31
143 0.34
144 0.4
145 0.43
146 0.51
147 0.6
148 0.66
149 0.73
150 0.81
151 0.87
152 0.88
153 0.85
154 0.84
155 0.83
156 0.82
157 0.79
158 0.75
159 0.72
160 0.65
161 0.6
162 0.53
163 0.47
164 0.38
165 0.31
166 0.3
167 0.27
168 0.27
169 0.23
170 0.22
171 0.17
172 0.16
173 0.15
174 0.11
175 0.07
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.07
183 0.06
184 0.06
185 0.07
186 0.06
187 0.09
188 0.13
189 0.16
190 0.2
191 0.21
192 0.21
193 0.22